2024-04-24 18:01:46, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001937 1749 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens dermatopontin (DPT), mRNA. ACCESSION NM_001937 VERSION NM_001937.4 GI:299758400 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1749) AUTHORS Yamatoji,M., Kasamatsu,A., Kouzu,Y., Koike,H., Sakamoto,Y., Ogawara,K., Shiiba,M., Tanzawa,H. and Uzawa,K. TITLE Dermatopontin: a potential predictor for metastasis of human oral cancer JOURNAL Int. J. Cancer 130 (12), 2903-2911 (2012) PUBMED 21796630 REMARK GeneRIF: data provided strong evidence that downregulation of DPT is a characteristic event in human oral squamous cell carcinoma and that DPT was correlated with cellular adhesion and invasiveness. REFERENCE 2 (bases 1 to 1749) AUTHORS Kato,A., Okamoto,O., Ishikawa,K., Sumiyoshi,H., Matsuo,N., Yoshioka,H., Nomizu,M., Shimada,T. and Fujiwara,S. TITLE Dermatopontin interacts with fibronectin, promotes fibronectin fibril formation, and enhances cell adhesion JOURNAL J. Biol. Chem. 286 (17), 14861-14869 (2011) PUBMED 21398523 REMARK GeneRIF: DPT has an accelerating role in fibroblast cell adhesion to the provisional matrix in the initial stage of wound healing. REFERENCE 3 (bases 1 to 1749) AUTHORS Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A. TITLE Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study JOURNAL Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009) PUBMED 19536175 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 4 (bases 1 to 1749) AUTHORS Li,X., Feng,P., Ou,J., Luo,Z., Dai,P., Wei,D. and Zhang,C. TITLE Dermatopontin is expressed in human liver and is downregulated in hepatocellular carcinoma JOURNAL Biochemistry Mosc. 74 (9), 979-985 (2009) PUBMED 19916908 REMARK GeneRIF: suggests that dermatopontin can play various roles in different tissues and might be a molecule related to carcinogenesis and the progression of HCC via possible interaction with TGF-beta1 and other potential mechanisms REFERENCE 5 (bases 1 to 1749) AUTHORS Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H., Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W. TITLE Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation JOURNAL Hum. Mol. Genet. 18 (4), 679-687 (2009) PUBMED 19064610 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 6 (bases 1 to 1749) AUTHORS Pochampally,R.R., Ylostalo,J., Penfornis,P., Matz,R.R., Smith,J.R. and Prockop,D.J. TITLE Histamine receptor H1 and dermatopontin: new downstream targets of the vitamin D receptor JOURNAL J. Bone Miner. Res. 22 (9), 1338-1349 (2007) PUBMED 17547532 REMARK GeneRIF: roles of dermatopontin and histamine receptor H1 genes as downstream targets for the VDR were confirmed by gel electromotility shift and chromatin immunoprecipitation assays that showed the presence of VDR complex binding sequences REFERENCE 7 (bases 1 to 1749) AUTHORS Kuroda,K., Okamoto,O. and Shinkai,H. TITLE Dermatopontin expression is decreased in hypertrophic scar and systemic sclerosis skin fibroblasts and is regulated by transforming growth factor-beta1, interleukin-4, and matrix collagen JOURNAL J. Invest. Dermatol. 112 (5), 706-710 (1999) PUBMED 10233760 REFERENCE 8 (bases 1 to 1749) AUTHORS Okamoto,O., Fujiwara,S., Abe,M. and Sato,Y. TITLE Dermatopontin interacts with transforming growth factor beta and enhances its biological activity JOURNAL Biochem. J. 337 (PT 3), 537-541 (1999) PUBMED 9895299 REFERENCE 9 (bases 1 to 1749) AUTHORS Forbes,E.G., Cronshaw,A.D., MacBeath,J.R. and Hulmes,D.J. TITLE Tyrosine-rich acidic matrix protein (TRAMP) is a tyrosine-sulphated and widely distributed protein of the extracellular matrix JOURNAL FEBS Lett. 351 (3), 433-436 (1994) PUBMED 8082810 REFERENCE 10 (bases 1 to 1749) AUTHORS Superti-Furga,A., Rocchi,M., Schafer,B.W. and Gitzelmann,R. TITLE Complementary DNA sequence and chromosomal mapping of a human proteoglycan-binding cell-adhesion protein (dermatopontin) JOURNAL Genomics 17 (2), 463-467 (1993) PUBMED 8104875 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BP257325.1, BC033736.1 and AI699890.1. On Jun 26, 2010 this sequence version replaced gi:32307171. Summary: Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CD685387.1, BC033736.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025083 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-564 BP257325.1 1-564 565-1717 BC033736.1 551-1703 1718-1749 AI699890.1 1-32 c FEATURES Location/Qualifiers source 1..1749 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1q12-q23" gene 1..1749 /gene="DPT" /gene_synonym="TRAMP" /note="dermatopontin" /db_xref="GeneID:1805" /db_xref="HGNC:3011" /db_xref="HPRD:00510" /db_xref="MIM:125597" exon 1..335 /gene="DPT" /gene_synonym="TRAMP" /inference="alignment:Splign:1.39.8" CDS 31..636 /gene="DPT" /gene_synonym="TRAMP" /note="tyrosine-rich acidic matrix protein" /codon_start=1 /product="dermatopontin precursor" /protein_id="NP_001928.2" /db_xref="GI:32307172" /db_xref="CCDS:CCDS1275.1" /db_xref="GeneID:1805" /db_xref="HGNC:3011" /db_xref="HPRD:00510" /db_xref="MIM:125597" /translation="
MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
" sig_peptide 31..84 /gene="DPT" /gene_synonym="TRAMP" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 85..633 /gene="DPT" /gene_synonym="TRAMP" /product="Dermatopontin" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q07507.2)" misc_feature 85..87 /gene="DPT" /gene_synonym="TRAMP" /inference="non-experimental evidence, no additional details recorded" /note="(By similarity); propagated from UniProtKB/Swiss-Prot (Q07507.2); other site" misc_feature 106..588 /gene="DPT" /gene_synonym="TRAMP" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q07507.2); Region: 2 X 53-55 AA tandem repeats" misc_feature 238..588 /gene="DPT" /gene_synonym="TRAMP" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q07507.2); Region: 3 X 6 AA repeats of D-R-[EQ]-W-[NQK]-[FY]" variation 145 /gene="DPT" /gene_synonym="TRAMP" /replace="a" /replace="g" /db_xref="dbSNP:998688" variation 270 /gene="DPT" /gene_synonym="TRAMP" /replace="a" /replace="g" /db_xref="dbSNP:1052591" variation 307 /gene="DPT" /gene_synonym="TRAMP" /replace="g" /replace="t" /db_xref="dbSNP:998689" exon 336..461 /gene="DPT" /gene_synonym="TRAMP" /inference="alignment:Splign:1.39.8" variation 385 /gene="DPT" /gene_synonym="TRAMP" /replace="a" /replace="t" /db_xref="dbSNP:11551958" variation 434 /gene="DPT" /gene_synonym="TRAMP" /replace="a" /replace="t" /db_xref="dbSNP:14395" exon 462..569 /gene="DPT" /gene_synonym="TRAMP" /inference="alignment:Splign:1.39.8" variation 470 /gene="DPT" /gene_synonym="TRAMP" /replace="c" /replace="t" /db_xref="dbSNP:11551959" exon 570..1728 /gene="DPT" /gene_synonym="TRAMP" /inference="alignment:Splign:1.39.8" STS 588..786 /gene="DPT" /gene_synonym="TRAMP" /standard_name="RH36563" /db_xref="UniSTS:31366" STS 1487..1614 /gene="DPT" /gene_synonym="TRAMP" /standard_name="RH103231" /db_xref="UniSTS:97563" STS 1496..1668 /gene="DPT" /gene_synonym="TRAMP" /standard_name="SHGC-75872" /db_xref="UniSTS:80307" ORIGIN
gtgacattgtttgccaaaatcccaggcagcatggacctcagtcttctctgggtacttctgcccctagtcaccatggcctggggccagtatggcgattatggatacccataccagcagtatcatgactacagcgatgatgggtgggtgaatttgaaccggcaaggcttcagctaccagtgtccccaggggcaggtgatagtggccgtgaggagcatcttcagcaagaaggaaggttctgacagacaatggaactacgcctgcatgcccacgccacagagcctcggggaacccacggagtgctggtgggaggagatcaacagggctggcatggaatggtaccagacgtgctccaacaatgggctggtggcaggattccagagccgctacttcgagtcagtgctggatcgggagtggcagttttactgttgtcgctacagcaagaggtgcccatattcctgctggctaacaacagaatatccaggtcactatggtgaggaaatggacatgatttcctacaattatgattactatatccgaggagcaacaaccactttctctgcagtggaaagggatcgccagtggaagttcataatgtgccggatgactgaatacgactgtgaatttgcaaatgtttagatttgccacataccaaatctgggtgaaaggaaaggggccggggacaggagggtgtccacatatgttaacatcagttggatctcctatagaagtttctgctgctctctttccttctccctgagctggtaactgcaatgccaacttcctgggcctttctgactagtatcacacttctaataaaatccacaattaaaccatgtttctcacttttcacatgtttcatagcaactgctttatatgactgatgatggcttccttgcacaccacatatacagtgcgcatgcttacagccgggcttctggagcaccagctgcagcctggctactgctttttactgcagaatgaactgcaagttcagcatagtggaggggagaggcagaactggaggagaggtgcagtgaaggttctctacagctaagcctgtttgaatgatacgtaggttccccaccaaaagcaggctttctgccctgagggacatcttcccactcccctgctccacatgagccatgcatgcttagcaatccaagtgcagagctctttgctccaggagtgaggagactgggaggtgaaatggggaaatggaagggtttggaggcagagctgaaaacagggttggaaggatttcctgaattagaagacaaacgttagcatacccagtaaggaaaatgagtgcaggggccaggggaacccgtgaggatcactctcaaatgagattaaaaacaaggaagcagagaatggtcagagaatgggattcagattgggaacttgtggggatgagagtgaccaggttgaactgggaagtggaaaaaggagtttgagtcactggcacctagaagcctgcccacgattcctaggaaggctggcagacaccctggaaccctggggagctactggcaaactctcctggattgggcctgatttttttggtgggaaaggctgccctggggatcaactttccttctgtgtgtggctcaggagttcttctgcagagatggcgctatctttcctcctcctgtgatgtcctgctcccaaccatttgtactcttcattacaaaagaaataaaaatattaacgttcactatgctgaaaataaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:1805 -> Biological process: GO:0007155 [cell adhesion] evidence: IEA GeneID:1805 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA GeneID:1805 -> Biological process: GO:0030199 [collagen fibril organization] evidence: IEA GeneID:1805 -> Cellular component: GO:0005578 [proteinaceous extracellular matrix] evidence: IEA GeneID:1805 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA GeneID:1805 -> Cellular component: GO:0031012 [extracellular matrix] evidence: IDA GeneID:1805 -> Cellular component: GO:0031012 [extracellular matrix] evidence: ISS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.