LOCUS       NM_001934               1765 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens distal-less homeobox 4 (DLX4), transcript variant 2,
            mRNA.
ACCESSION   NM_001934
VERSION     NM_001934.3  GI:356995877
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1765)
  AUTHORS   Zhang,L., Yang,M., Gan,L., He,T., Xiao,X., Stewart,M.D., Liu,X.,
            Yang,L., Zhang,T., Zhao,Y. and Fu,J.
  TITLE     DLX4 upregulates TWIST and enhances tumor migration, invasion and
            metastasis
  JOURNAL   Int. J. Biol. Sci. 8 (8), 1178-1187 (2012)
   PUBMED   23091415
  REMARK    GeneRIF: DLX4 induces cancer cells to undergo epithelial to
            mesenchymal transition through TWIST, enhancing tumor migration,
            invasion and metastasis.
REFERENCE   2  (bases 1 to 1765)
  AUTHORS   Sun,Y.Y., Lu,M., Xi,X.W., Qiao,Q.Q., Chen,L.L., Xu,X.M. and
            Feng,Y.J.
  TITLE     Regulation of epithelial-mesenchymal transition by homeobox gene
            DLX4 in JEG-3 trophoblast cells: a role in preeclampsia
  JOURNAL   Reprod Sci 18 (11), 1138-1145 (2011)
   PUBMED   21602546
  REMARK    GeneRIF: findings suggest that decreased expression of homeobox
            protein DLX-4 leads to the pathogenesis of preeclampsia by
            inhibiting epithelial-mesenchymal transition in trophoblasts
REFERENCE   3  (bases 1 to 1765)
  AUTHORS   Trinh,B.Q., Barengo,N. and Naora,H.
  TITLE     Homeodomain protein DLX4 counteracts key transcriptional control
            mechanisms of the TGF-beta cytostatic program and blocks the
            antiproliferative effect of TGF-beta
  JOURNAL   Oncogene 30 (24), 2718-2729 (2011)
   PUBMED   21297662
  REMARK    GeneRIF: The ability of DLX4 to counteract key transcriptional
            control mechanisms of the TGF-beta cytostatic program could
            explain, in part, the resistance of tumors to the antiproliferative
            effect of TGF-beta.
REFERENCE   4  (bases 1 to 1765)
  AUTHORS   Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J.,
            Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S.,
            Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C.
  TITLE     Maternal genes and facial clefts in offspring: a comprehensive
            search for genetic associations in two population-based cleft
            studies from Scandinavia
  JOURNAL   PLoS ONE 5 (7), E11493 (2010)
   PUBMED   20634891
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1765)
  AUTHORS   Man,Y.G., Schwartz,A., Levine,P.H., Teal,C. and Berg,P.E.
  TITLE     BP1, a putative signature marker for inflammatory breast cancer and
            tumor aggressiveness
  JOURNAL   Cancer Biomark 5 (1), 9-17 (2009)
   PUBMED   19242057
  REMARK    GeneRIF: High BP1 expression is associated with inflammatory breast
            cancer and tumor aggressiveness
REFERENCE   6  (bases 1 to 1765)
  AUTHORS   Price,J.A., Bowden,D.W., Wright,J.T., Pettenati,M.J. and Hart,T.C.
  TITLE     Identification of a mutation in DLX3 associated with
            tricho-dento-osseous (TDO) syndrome
  JOURNAL   Hum. Mol. Genet. 7 (3), 563-569 (1998)
   PUBMED   9467018
REFERENCE   7  (bases 1 to 1765)
  AUTHORS   Quinn,L.M., Latham,S.E. and Kalionis,B.
  TITLE     A distal-less class homeobox gene, DLX4, is a candidate for
            regulating epithelial-mesenchymal cell interactions in the human
            placenta
  JOURNAL   Placenta 19 (1), 87-93 (1998)
   PUBMED   9481790
REFERENCE   8  (bases 1 to 1765)
  AUTHORS   Morasso,M.I., Yonescu,R., Griffin,C.A. and Sargent,T.D.
  TITLE     Localization of human DLX8 to chromosome 17q21.3-q22 by
            fluorescence in situ hybridization
  JOURNAL   Mamm. Genome 8 (4), 302-303 (1997)
   PUBMED   9096128
REFERENCE   9  (bases 1 to 1765)
  AUTHORS   Quinn,L.M., Johnson,B.V., Nicholl,J., Sutherland,G.R. and
            Kalionis,B.
  TITLE     Isolation and identification of homeobox genes from the human
            placenta including a novel member of the Distal-less family, DLX4
  JOURNAL   Gene 187 (1), 55-61 (1997)
   PUBMED   9073066
REFERENCE   10 (bases 1 to 1765)
  AUTHORS   Nakamura,S., Stock,D.W., Wydner,K.L., Bollekens,J.A., Takeshita,K.,
            Nagai,B.M., Chiba,S., Kitamura,T., Freeland,T.M., Zhao,Z.,
            Minowada,J., Lawrence,J.B., Weiss,K.M. and Ruddle,F.H.
  TITLE     Genomic analysis of a new mammalian distal-less gene: Dlx7
  JOURNAL   Genomics 38 (3), 314-324 (1996)
   PUBMED   8975708
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from U73328.1, BG479840.1,
            BC016145.1, BX105774.1 and CB131875.1.
            On Nov 15, 2011 this sequence version replaced gi:20143959.
            
            Summary: Many vertebrate homeo box-containing genes have been
            identified on the basis of their sequence similarity with
            Drosophila developmental genes. Members of the Dlx gene family
            contain a homeobox that is related to that of Distal-less (Dll), a
            gene expressed in the head and limbs of the developing fruit fly.
            The Distal-less (Dlx) family of genes comprises at least 6
            different members, DLX1-DLX6. The DLX proteins are postulated to
            play a role in forebrain and craniofacial development. Three
            transcript variants have been described for this gene, however, the
            full length nature of one variant has not been described. Studies
            of the two splice variants revealed that one encoded isoform
            functions as a repressor of the beta-globin gene while the other
            isoform lacks that function. [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (2) differs at the 5' end, and
            utilizes an alternate start codon compared to variant 1. This
            results in a shorter isoform (b) with a distinct N-terminus
            compared to isoform a, and lacks the beta-globin repressor
            function.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U73328.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-262               U73328.1           7-268
            263-361             BG479840.1         86-184
            362-569             U73328.1           368-575
            570-1103            BC016145.1         818-1351
            1104-1399           U73328.1           1108-1403
            1400-1653           BX105774.1         228-481
            1654-1765           CB131875.1         1-112               c
FEATURES             Location/Qualifiers
     source          1..1765
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21.33"
     gene            1..1765
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /note="distal-less homeobox 4"
                     /db_xref="GeneID:1748"
                     /db_xref="HGNC:2917"
                     /db_xref="HPRD:03553"
                     /db_xref="MIM:601911"
     exon            1..504
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    118..120
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /note="upstream in-frame stop codon"
     variation       178
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139488744"
     variation       205
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187087248"
     CDS             241..747
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /note="isoform b is encoded by transcript variant 2;
                     distal-less homeo box 9; beta protein 1; homeobox protein
                     DLX-4; distal-less homeo box 7; homeobox protein DLX-7;
                     homeobox protein DLX-8"
                     /codon_start=1
                     /product="homeobox protein DLX-4 isoform b"
                     /protein_id="NP_001925.2"
                     /db_xref="GI:20143960"
                     /db_xref="CCDS:CCDS45728.1"
                     /db_xref="GeneID:1748"
                     /db_xref="HGNC:2917"
                     /db_xref="HPRD:03553"
                     /db_xref="MIM:601911"
                     /translation="

MKLSVLPPRSLLAPYTVLCCPPDSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM

"
     misc_feature    376..546
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(376..390,394..396,445..447,463..465,502..504,
                     508..513,520..525,529..537,541..546)
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(382..384,391..393,511..513,520..525,532..534)
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       259
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370757334"
     variation       366..367
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:370138317"
     variation       377
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372156240"
     STS             396..692
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /standard_name="PMC20354P1"
                     /db_xref="UniSTS:271934"
     variation       428
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:151318731"
     variation       483
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370377249"
     variation       486
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150742579"
     STS             489..542
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /standard_name="ksks321"
                     /db_xref="UniSTS:514366"
     variation       495
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139118373"
     exon            505..1763
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /inference="alignment:Splign:1.39.8"
     variation       529
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149498057"
     variation       531
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200916126"
     variation       549
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146002721"
     variation       570
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368164202"
     variation       580
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139954414"
     variation       620
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150024578"
     variation       628
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372590740"
     variation       631
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201875580"
     variation       642
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146281851"
     variation       694
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1058559"
     variation       731
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202154782"
     variation       732
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369561537"
     variation       761
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192533761"
     variation       762
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371538328"
     variation       787..788
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="agcccaggacccaggcagtccacctgcac"
                     /db_xref="dbSNP:60243053"
     variation       794
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201620636"
     variation       887
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1058560"
     variation       920
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1058561"
     variation       1069
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75953192"
     variation       1074
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142428478"
     variation       1104
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1058562"
     variation       1174..1175
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:201251660"
     variation       1206
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146419987"
     variation       1212
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1058564"
     STS             1263..1371
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /standard_name="RH36424"
                     /db_xref="UniSTS:9030"
     variation       1309
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184512405"
     variation       1389..1390
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375951477"
     variation       1389
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:143029210"
     variation       1390..1391
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:11429140"
     variation       1404..1405
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="a"
                     /replace="aaa"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:10677419"
     variation       1405..1406
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="aa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:36061264"
     variation       1435..1436
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34108300"
     variation       1534
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:4793623"
     variation       1557
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147873124"
     STS             1565..1716
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /standard_name="RH12668"
                     /db_xref="UniSTS:49797"
     variation       1572
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8066341"
     variation       1713
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373728187"
     polyA_signal    1739..1744
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
     polyA_site      1763
                     /gene="DLX4"
                     /gene_synonym="BP1; DLX7; DLX8; DLX9"
ORIGIN      

ccgcaggcgccgcggtaccctggctgtggccctcggcgctttcttcctagggtcacaggacccatacgagtgggagctccctgggagcagaactgcgtcttgtatcacctggcgcggtgaacgtgggggttgaaacgctccacgcggaaggtagagggcaggggccaagggggcgatcctggtggctgcgctttttgctatttgctgccgacggcatgcagacgagatgcaaataagcttatgaaactgtccgtcctaccccctcgctccctcctcgccccctacaccgtgttgtgctgcccaccagactcggagaagccgcggctgtccccggaaccctccgagcggcgccctcaggcccccgccaaaaagctccgcaagccgaggaccatctactccagcctgcagctgcagcacctaaaccagcgtttccagcacacgcagtacctggcgctgcccgagagggcccagctggcagcgcagctcggcctcacccagacccaggtaaagatctggtttcagaacaaacgctccaagtataagaagctcctgaagcagaattctggggggcaggaaggggacttccctgggaggaccttctctgtgtctccctgctccccacccctcccctccctctgggatctacccaaggcagggaccctgcccaccagtggctatggcaacagctttggagcctggtatcagcatcactcctcagatgtcctggcttcgcctcagatgatgtgaatctggggaagggcgggtcaggcccacagccttcctgcaaagcccaggacccaggcagtccacctgcaccccttctgggctgggaggaaaccagctccagatgggttttctctggaggacaagcagttagaggagaaaaaggaatggagcagagcctgtacccctaaccctaacagctaaatcaaggacctcagccttatataatcattgtccccaccactaccatggactggacaccttcactccagctggacaaagactctggagagagagccattggctggagttgagactgtccccagaacccttggtcttgccactcccccactccttcttccctctctccctttctcctctccctgctttcttgaaaaggactgaatcgccactacagcctgggtgcaaaatcagcaagaaacattgagtatttttttttctttgtatgcctttggccttgcacaacccatttgtgagcaaaagcagaagtggaccaccatcagctcccacccacccagcgatttttccttggaggtcagcccgttacccccataactgatttacctacttaccatactgggaggtagaagagatgcagagaaatgtggaatttgtggacctatgggtaatttatgctttcctcctaaaaaaaaaaaaaaagccctctttcccaccccctccccatctcccctttttgaatagataatggatccaattatccatataattcaataggtatttattgagaggctcccttctattccccatccctaatccctaacgaacccacgggcacacacttttggaaacctggtaaagtaacacttagggggaaatggggacaaactggctctctggattagtgcgggtatagacacccccaaataggtgggtaggcccattgattcagctccttgcagctgtctctgttcaaaggaactgtgcagatttagaacgaattggagcttgagcttcacaccaccagcttccagagattaaagtttgtacaaaacattgcaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1748 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
            GeneID:1748 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS
            GeneID:1748 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:1748 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IDA
            GeneID:1748 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS
            GeneID:1748 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA
            GeneID:1748 -> Cellular component: GO:0005634 [nucleus] evidence: NAS