Home |
Help |
Advanced search
2024-04-25 05:49:39, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001896 1674 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens casein kinase 2, alpha prime polypeptide (CSNK2A2),
mRNA.
ACCESSION NM_001896
VERSION NM_001896.2 GI:38708325
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1674)
AUTHORS Olsen,B.B., Fischer,U., Rasmussen,T.L., Montenarh,M., Meese,E.,
Fritz,G. and Issinger,O.G.
TITLE Lack of the catalytic subunit of DNA-dependent protein kinase
(DNA-PKcs) is accompanied by increased CK2alpha' levels
JOURNAL Mol. Cell. Biochem. 356 (1-2), 139-147 (2011)
PUBMED 21750982
REMARK GeneRIF: Lack of DNA-PKcs is accompanied by an increase in the
protein level of one of the catalytic isozymes of protein kinase
CK2, i.e., CK2alpha' and a concomitant increase in CK2 activity.
REFERENCE 2 (bases 1 to 1674)
AUTHORS Bischoff,N., Raaf,J., Olsen,B., Bretner,M., Issinger,O.G. and
Niefind,K.
TITLE Enzymatic activity with an incomplete catalytic spine: insights
from a comparative structural analysis of human CK2alpha and its
paralogous isoform CK2alpha'
JOURNAL Mol. Cell. Biochem. 356 (1-2), 57-65 (2011)
PUBMED 21739153
REMARK GeneRIF: In hsCK2alpha' an open conformation of the interdomain
hinge/helix alphaD region that is critical for ATP-binding is found
corresponding to an incomplete catalytic spine. In contrast
hsCK2alpha often adopts the canonical, PKA-like version of the
catalytic spine.
REFERENCE 3 (bases 1 to 1674)
AUTHORS Plotnikov,A., Chuderland,D., Karamansha,Y., Livnah,O. and Seger,R.
TITLE Nuclear extracellular signal-regulated kinase 1 and 2 translocation
is mediated by casein kinase 2 and accelerated by
autophosphorylation
JOURNAL Mol. Cell. Biol. 31 (17), 3515-3530 (2011)
PUBMED 21730285
REMARK GeneRIF: Results provide an important role of CK2 in regulating
nuclear ERK activities.
REFERENCE 4 (bases 1 to 1674)
AUTHORS Raaf,J., Bischoff,N., Klopffleisch,K., Brunstein,E., Olsen,B.B.,
Vilk,G., Litchfield,D.W., Issinger,O.G. and Niefind,K.
TITLE Interaction between CK2alpha and CK2beta, the subunits of protein
kinase CK2: thermodynamic contributions of key residues on the
CK2alpha surface
JOURNAL Biochemistry 50 (4), 512-522 (2011)
PUBMED 21142136
REMARK GeneRIF: A thorough investigation of CK2alpha identifies key
energetic hot spots on the surface of CK2alpha and their
thermostability and catalytic activity in comparison to the wild
type subunit.
REFERENCE 5 (bases 1 to 1674)
AUTHORS Ferguson,A.D., Sheth,P.R., Basso,A.D., Paliwal,S., Gray,K.,
Fischmann,T.O. and Le,H.V.
TITLE Structural basis of CX-4945 binding to human protein kinase CK2
JOURNAL FEBS Lett. 585 (1), 104-110 (2011)
PUBMED 21093442
REMARK GeneRIF: Data presented the crystal structures of CK2alpha in
complex with CX-4945 and adenylyl phosphoramidate at 2.7 and 1.3 A,
respectively.
REFERENCE 6 (bases 1 to 1674)
AUTHORS Hagiwara,T., Nakaya,K., Nakamura,Y., Nakajima,H., Nishimura,S. and
Taya,Y.
TITLE Specific phosphorylation of the acidic central region of the N-myc
protein by casein kinase II
JOURNAL Eur. J. Biochem. 209 (3), 945-950 (1992)
PUBMED 1425701
REFERENCE 7 (bases 1 to 1674)
AUTHORS Lin,A., Frost,J., Deng,T., Smeal,T., al-Alawi,N., Kikkawa,U.,
Hunter,T., Brenner,D. and Karin,M.
TITLE Casein kinase II is a negative regulator of c-Jun DNA binding and
AP-1 activity
JOURNAL Cell 70 (5), 777-789 (1992)
PUBMED 1516134
REMARK Erratum:[Cell. 1992 Nov 27;71(5):887. PMID: 1423636]
REFERENCE 8 (bases 1 to 1674)
AUTHORS Sacks,D.B., Davis,H.W., Crimmins,D.L. and McDonald,J.M.
TITLE Insulin-stimulated phosphorylation of calmodulin
JOURNAL Biochem. J. 286 (PT 1), 211-216 (1992)
PUBMED 1520270
REFERENCE 9 (bases 1 to 1674)
AUTHORS Schubert,U., Schneider,T., Henklein,P., Hoffmann,K., Berthold,E.,
Hauser,H., Pauli,G. and Porstmann,T.
TITLE Human-immunodeficiency-virus-type-1-encoded Vpu protein is
phosphorylated by casein kinase II
JOURNAL Eur. J. Biochem. 204 (2), 875-883 (1992)
PUBMED 1541298
REFERENCE 10 (bases 1 to 1674)
AUTHORS Marais,R.M., Hsuan,J.J., McGuigan,C., Wynne,J. and Treisman,R.
TITLE Casein kinase II phosphorylation increases the rate of serum
response factor-binding site exchange
JOURNAL EMBO J. 11 (1), 97-105 (1992)
PUBMED 1740119
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AI150700.1 and BC008812.2.
On Dec 5, 2003 this sequence version replaced gi:4503096.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC008812.2 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-126 AI150700.1 1-126
127-1674 BC008812.2 1-1548
FEATURES Location/Qualifiers
source 1..1674
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16q21"
gene 1..1674
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/note="casein kinase 2, alpha prime polypeptide"
/db_xref="GeneID:1459"
/db_xref="HGNC:2459"
/db_xref="HPRD:00279"
/db_xref="MIM:115442"
exon 1..246
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
CDS 143..1195
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/EC_number="2.7.11.1"
/note="CK II alpha'"
/codon_start=1
/product="casein kinase II subunit alpha'"
/protein_id="NP_001887.1"
/db_xref="GI:4503097"
/db_xref="CCDS:CCDS10794.1"
/db_xref="GeneID:1459"
/db_xref="HGNC:2459"
/db_xref="HPRD:00279"
/db_xref="MIM:115442"
/translation="
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
"
misc_feature 179..181
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine; propagated from
UniProtKB/Swiss-Prot (P19784.1); phosphorylation site"
misc_feature 194..196
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P19784.1); phosphorylation site"
misc_feature 203..205
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P19784.1); phosphorylation site"
misc_feature 260..1117
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/note="Protein Kinases, catalytic domain; Region:
PKc_like; cl09925"
/db_xref="CDD:214163"
misc_feature 260..1117
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/note="Protein kinase domain; Region: Pkinase; pfam00069"
/db_xref="CDD:200973"
misc_feature order(278..292,302..304,341..343,347..349,428..430,
482..493,503..505,509..511,611..613,617..619,623..628,
632..634,668..670,677..679,722..733)
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/note="active site"
/db_xref="CDD:173623"
misc_feature order(278..292,302..304,341..343,347..349,428..430,
482..493,503..505,611..613,617..619,623..628,632..634,
668..670)
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173623"
misc_feature order(290..292,503..505,509..511,611..613,617..619,
623..625,677..679,722..733)
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173623"
misc_feature 431..433
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P19784.1); acetylation site"
misc_feature order(665..682,722..733)
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173623"
misc_feature 1004..1006
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P19784.1); phosphorylation site"
exon 247..358
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 359..460
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 461..511
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 512..571
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 572..655
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 656..766
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
variation 727
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2292027"
exon 767..868
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
STS 783..987
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/standard_name="CSNK2A2"
/db_xref="UniSTS:253714"
exon 869..969
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 970..1118
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 1119..1212
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
exon 1213..1659
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/inference="alignment:Splign:1.39.8"
STS 1293..1569
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/standard_name="SHGC-60810"
/db_xref="UniSTS:66778"
STS 1376..1558
/gene="CSNK2A2"
/gene_synonym="CK2A2; CSNK2A1"
/standard_name="D16S3204"
/db_xref="UniSTS:32932"
ORIGIN
gcggccgcccgccgccgcgctcctcctcctcctcctccagcgcccggcggcccgctgcctcctccgcccgacgccccgcgtcccccgccgcgccgccgccgccaccctctgcgccccgcgccgccccccggtcccgcccgccatgcccggcccggccgcgggcagcagggcccgggtctacgccgaggtgaacagtctgaggagccgcgagtactgggactacgaggctcacgtcccgagctggggtaatcaagatgattaccaactggttcgaaaacttggtcggggaaaatatagtgaagtatttgaggccattaatatcaccaacaatgagagagtggttgtaaaaatcctgaagccagtgaagaaaaagaagataaaacgagaggttaagattctggagaaccttcgtggtggaacaaatatcattaagctgattgacactgtaaaggaccccgtgtcaaagacaccagctttggtatttgaatatatcaataatacagattttaagcaactctaccagatcctgacagactttgatatccggttttatatgtatgaactacttaaagctctggattactgccacagcaagggaatcatgcacagggatgtgaaacctcacaatgtcatgatagatcaccaacagaaaaagctgcgactgatagattggggtctggcagaattctatcatcctgctcaggagtacaatgttcgtgtagcctcaaggtacttcaagggaccagagctcctcgtggactatcagatgtatgattatagcttggacatgtggagtttgggctgtatgttagcaagcatgatctttcgaagggaaccattcttccatggacaggacaactatgaccagcttgttcgcattgccaaggttctgggtacagaagaactgtatgggtatctgaagaagtatcacatagacctagatccacacttcaacgatatcctgggacaacattcacggaaacgctgggaaaactttatccatagtgagaacagacaccttgtcagccctgaggccctagatcttctggacaaacttctgcgatacgaccatcaacagagactgactgccaaagaggccatggagcacccatacttctaccctgtggtgaaggagcagtcccagccttgtgcagacaatgctgtgctttccagtggtctcacggcagcacgatgaagactggaaagcgacgggtctgttgcggttctcccacttttccataagcagaacaagaaccaaatcaaacgtcttaacgcgtatagagagatcacgttccgtgagcagacacaaaacggtggcaggtttggcgagcacgaactagaccaagcgaagggcagcccaccaccgtatatcaaacctcacttccgaatgtaaaaggctcacttgcctttggcttcctgttgacttcttcccgacccagaaagcatggggaatgtgaagggtatgcagaatgttgttggttactgttgctccccgagcccctcaactcgtcccgtggccgcctgtttttccagcaaaccacgctaactagctgaccacagactccacagtggggggacgggcgcagtatgtggcatggcggcagttacatattattattttaaaagtatatattattgaataaaaggttttaaaagaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:1459 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IEA
GeneID:1459 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:1459 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:1459 -> Molecular function: GO:0047485 [protein N-terminus binding] evidence: IPI
GeneID:1459 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:1459 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:1459 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
GeneID:1459 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:1459 -> Biological process: GO:0007411 [axon guidance] evidence: TAS
GeneID:1459 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA
GeneID:1459 -> Biological process: GO:0071174 [mitotic spindle checkpoint] evidence: IMP
GeneID:1459 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:1459 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:1459 -> Cellular component: GO:0031519 [PcG protein complex] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001887 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.