Home |
Help |
Advanced search
2024-04-25 20:14:47, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001841 1789 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens cannabinoid receptor 2 (macrophage) (CNR2), mRNA.
ACCESSION NM_001841
VERSION NM_001841.2 GI:206725541
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1789)
AUTHORS Rajasekaran,M., Brents,L.K., Franks,L.N., Moran,J.H. and
Prather,P.L.
TITLE Human metabolites of synthetic cannabinoids JWH-018 and JWH-073
bind with high affinity and act as potent agonists at cannabinoid
type-2 receptors
JOURNAL Toxicol. Appl. Pharmacol. 269 (2), 100-108 (2013)
PUBMED 23537664
REMARK GeneRIF: These results indicate that JWH-018, JWH-073 and several
major human metabolites of these compounds exhibit high affinity
and demonstrate distinctive signaling properties at CB2 receptors.
REFERENCE 2 (bases 1 to 1789)
AUTHORS Solas,M., Francis,P.T., Franco,R. and Ramirez,M.J.
TITLE CB2 receptor and amyloid pathology in frontal cortex of Alzheimer's
disease patients
JOURNAL Neurobiol. Aging 34 (3), 805-808 (2013)
PUBMED 22763024
REMARK GeneRIF: The level of CB(2)R was significantly higher (40%) in
Alzheimer disease. CB(2)R expression did not correlate with
cognitive status.
REFERENCE 3 (bases 1 to 1789)
AUTHORS Mitjans,M., Gasto,C., Catalan,R., Fananas,L. and Arias,B.
TITLE Genetic variability in the endocannabinoid system and 12-week
clinical response to citalopram treatment: the role of the CNR1,
CNR2 and FAAH genes
JOURNAL J. Psychopharmacol. (Oxford) 26 (10), 1391-1398 (2012)
PUBMED 22826533
REMARK GeneRIF: genetic association studies in a population in Spain: Data
suggest that an SNP in CNR2 (rs2501431; G allele carriers versus AA
homozygotes) is associated with a better response to citalopram
treatment in patients with major depressive disorder.
REFERENCE 4 (bases 1 to 1789)
AUTHORS Rossi,F., Bellini,G., Alisi,A., Alterio,A., Maione,S., Perrone,L.,
Locatelli,F., Miraglia del Giudice,E. and Nobili,V.
TITLE Cannabinoid receptor type 2 functional variant influences liver
damage in children with non-alcoholic fatty liver disease
JOURNAL PLoS ONE 7 (8), E42259 (2012)
PUBMED 22927922
REMARK GeneRIF: a critical role for CB2 Q63R variant in modulating hepatic
inflammation state in obese children and in the consequent
increased predisposition of these patients to liver damage
REFERENCE 5 (bases 1 to 1789)
AUTHORS Arnold,J.C., Hone,P., Holland,M.L. and Allen,J.D.
TITLE CB2 and TRPV1 receptors mediate cannabinoid actions on MDR1
expression in multidrug resistant cells
JOURNAL Pharmacol Rep 64 (3), 751-757 (2012)
PUBMED 22814029
REMARK GeneRIF: This is the first evidence that CB(2) and TRPV(1)
receptors cooperate to modulate MDR1 expression.
REFERENCE 6 (bases 1 to 1789)
AUTHORS Nong,L., Newton,C., Friedman,H. and Klein,T.W.
TITLE CB1 and CB2 receptor mRNA expression in human peripheral blood
mononuclear cells (PBMC) from various donor types
JOURNAL Adv. Exp. Med. Biol. 493, 229-233 (2001)
PUBMED 11727770
REMARK GeneRIF: CB1 and CB2 receptor mRNA expression in human peripheral
blood mononuclear cells (PBMC) from various donor types.
REFERENCE 7 (bases 1 to 1789)
AUTHORS Tao,Q., McAllister,S.D., Andreassi,J., Nowell,K.W., Cabral,G.A.,
Hurst,D.P., Bachtel,K., Ekman,M.C., Reggio,P.H. and Abood,M.E.
TITLE Role of a conserved lysine residue in the peripheral cannabinoid
receptor (CB2): evidence for subtype specificity
JOURNAL Mol. Pharmacol. 55 (3), 605-613 (1999)
PUBMED 10051546
REFERENCE 8 (bases 1 to 1789)
AUTHORS Shire,D., Calandra,B., Rinaldi-Carmona,M., Oustric,D., Pessegue,B.,
Bonnin-Cabanne,O., Le Fur,G., Caput,D. and Ferrara,P.
TITLE Molecular cloning, expression and function of the murine CB2
peripheral cannabinoid receptor
JOURNAL Biochim. Biophys. Acta 1307 (2), 132-136 (1996)
PUBMED 8679694
REFERENCE 9 (bases 1 to 1789)
AUTHORS Galiegue,S., Mary,S., Marchand,J., Dussossoy,D., Carriere,D.,
Carayon,P., Bouaboula,M., Shire,D., Le Fur,G. and Casellas,P.
TITLE Expression of central and peripheral cannabinoid receptors in human
immune tissues and leukocyte subpopulations
JOURNAL Eur. J. Biochem. 232 (1), 54-61 (1995)
PUBMED 7556170
REFERENCE 10 (bases 1 to 1789)
AUTHORS Munro,S., Thomas,K.L. and Abu-Shaar,M.
TITLE Molecular characterization of a peripheral receptor for
cannabinoids
JOURNAL Nature 365 (6441), 61-65 (1993)
PUBMED 7689702
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from X74328.1, AL590609.15 and
BC069722.1.
On Sep 26, 2008 this sequence version replaced gi:4502928.
Summary: The cannabinoid delta-9-tetrahydrocannabinol is the
principal psychoactive ingredient of marijuana. The proteins
encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1)
gene have the characteristics of a guanine nucleotide-binding
protein (G-protein)-coupled receptor for cannabinoids. They inhibit
adenylate cyclase activity in a dose-dependent, stereoselective,
and pertussis toxin-sensitive manner. These proteins have been
found to be involved in the cannabinoid-induced CNS effects
(including alterations in mood and cognition) experienced by users
of marijuana. The cannabinoid receptors are members of family 1 of
the G-protein-coupled receptors. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: X74328.1, DR004211.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025089 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-31 X74328.1 1-31
32-32 AL590609.15 46318-46318 c
33-1449 X74328.1 32-1448
1450-1732 BC069722.1 1391-1673
1733-1789 X74328.1 1734-1790
FEATURES Location/Qualifiers
source 1..1789
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1p36.11"
gene 1..1789
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/note="cannabinoid receptor 2 (macrophage)"
/db_xref="GeneID:1269"
/db_xref="HGNC:2160"
/db_xref="HPRD:05444"
/db_xref="MIM:605051"
exon 1..82
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="alignment:Splign:1.39.8"
exon 83..1775
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="alignment:Splign:1.39.8"
STS 100..1235
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/db_xref="UniSTS:481892"
misc_feature 113..115
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/note="upstream in-frame stop codon"
CDS 128..1210
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/note="testis-dominant CNR2 isoform CB2"
/codon_start=1
/product="cannabinoid receptor 2"
/protein_id="NP_001832.1"
/db_xref="GI:4502929"
/db_xref="CCDS:CCDS245.1"
/db_xref="GeneID:1269"
/db_xref="HGNC:2160"
/db_xref="HPRD:05444"
/db_xref="MIM:605051"
/translation="
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
"
misc_feature 227..304
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P34972.1);
transmembrane region"
misc_feature 296..1024
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/note="7 transmembrane receptor (rhodopsin family);
Region: 7tm_1; pfam00001"
/db_xref="CDD:200918"
misc_feature 341..403
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P34972.1);
transmembrane region"
misc_feature 440..514
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P34972.1);
transmembrane region"
misc_feature 575..643
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P34972.1);
transmembrane region"
misc_feature 692..769
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P34972.1);
transmembrane region"
misc_feature 866..928
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P34972.1);
transmembrane region"
misc_feature 965..1030
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P34972.1);
transmembrane region"
misc_feature 1181..1183
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P34972.1); phosphorylation site"
variation 316
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="g"
/db_xref="dbSNP:2502992"
variation 973
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="c"
/replace="t"
/db_xref="dbSNP:2502993"
variation 1073
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="c"
/replace="t"
/db_xref="dbSNP:2229579"
variation 1126
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="g"
/db_xref="dbSNP:2229580"
variation 1141
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="c"
/replace="g"
/db_xref="dbSNP:2229581"
variation 1233
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="c"
/replace="g"
/db_xref="dbSNP:2229582"
variation 1252
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="g"
/db_xref="dbSNP:2229583"
variation 1266
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="g"
/db_xref="dbSNP:2229584"
variation 1314
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="g"
/db_xref="dbSNP:2229585"
variation 1332
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="c"
/replace="g"
/db_xref="dbSNP:2229586"
STS 1355..1593
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/standard_name="GDB:435196"
/db_xref="UniSTS:157214"
STS 1355..1507
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/standard_name="RH121875"
/db_xref="UniSTS:136619"
STS 1395..1593
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/standard_name="WIAF-1577"
/db_xref="UniSTS:27044"
variation 1435
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="g"
/db_xref="dbSNP:1105"
variation 1463
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="c"
/replace="g"
/db_xref="dbSNP:1106"
variation 1479
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="t"
/db_xref="dbSNP:1130316"
variation 1629
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="c"
/replace="t"
/db_xref="dbSNP:1130320"
variation 1711
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
/replace="a"
/replace="g"
/db_xref="dbSNP:1130321"
polyA_site 1775
/gene="CNR2"
/gene_synonym="CB-2; CB2; CX5"
ORIGIN
caggtcctgggagaggacagaaaacaactgggactcctcagcccccggcagctcccagtgcccagccacccacaacacaacccaaagccttctagacaagctcagtggaatctgaagggcccaccccatggaggaatgctgggtgacagagatagccaatggctccaaggatggcttggattccaaccctatgaaggattacatgatcctgagtggtccccagaagacagctgttgctgtgttgtgcactcttctgggcctgctaagtgccctggagaacgtggctgtgctctatctgatcctgtcctcccaccaactccgccggaagccctcatacctgttcattggcagcttggctggggctgacttcctggccagtgtggtctttgcatgcagctttgtgaatttccatgttttccatggtgtggattccaaggctgtcttcctgctgaagattggcagcgtgactatgaccttcacagcctctgtgggtagcctcctgctgaccgccattgaccgatacctctgcctgcgctatccaccttcctacaaagctctgctcacccgtggaagggcactggtgaccctgggcatcatgtgggtcctctcagcactagtctcctacctgcccctcatgggatggacttgctgtcccaggccctgctctgagcttttcccactgatccccaatgactacctgctgagctggctcctgttcatcgccttcctcttttccggaatcatctacacctatgggcatgttctctggaaggcccatcagcatgtggccagcttgtctggccaccaggacaggcaggtgccaggaatggcccgaatgaggctggatgtgaggttggccaagaccctagggctagtgttggctgtgctcctcatctgttggttcccagtgctggccctcatggcccacagcctggccactacgctcagtgaccaggtcaagaaggcctttgctttctgctccatgctgtgcctcatcaactccatggtcaaccctgtcatctatgctctacggagtggagagatccgctcctctgcccatcactgcctggctcactggaagaagtgtgtgaggggccttgggtcagaggcaaaagaagaagccccgagatcctcagtcaccgagacagaggctgatgggaaaatcactccgtggccagattccagagatctagacctctctgattgctgatgaggcctcttcccaatttaaacaactcaagtcagaaatcagttcactccctggaagagagagaggggtcttggcactctcttcttacttaaaccagtcccagacacctagacacggacccctttttgctgatgagtgttgggactgactcctggaagacagcctggccttgcccacctgcacacagtctgttggataggtagggccacgaggagtagccaggtaggcgagacacaaaaggcctgggacagggtcagtacaagtcaggtcaggcttcatgcctgcatcctccagagaccacaggagccaaagcgagcctccaggcccagcaatgagggacttgggagaaatctgagaagaatgggttgttctcttgggaagtcagggtatcagatgggatggacatccaggtcttctctctgcctaattgtcaaggcctccttggctctggagctatgaaaggccccactttcaagtcacccttgccactgaggaccgaggactatgctatgatgaggattaaggtgttgacttgcctctttcagagataaatgacaagccttcaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:1269 -> Molecular function: GO:0004949 [cannabinoid receptor activity] evidence: IEA
GeneID:1269 -> Biological process: GO:0001975 [response to amphetamine] evidence: IEA
GeneID:1269 -> Biological process: GO:0006954 [inflammatory response] evidence: IEA
GeneID:1269 -> Biological process: GO:0006955 [immune response] evidence: TAS
GeneID:1269 -> Biological process: GO:0007187 [G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger] evidence: TAS
GeneID:1269 -> Biological process: GO:0007610 [behavior] evidence: IEA
GeneID:1269 -> Biological process: GO:0019233 [sensory perception of pain] evidence: IEA
GeneID:1269 -> Biological process: GO:0032229 [negative regulation of synaptic transmission, GABAergic] evidence: IEA
GeneID:1269 -> Biological process: GO:0032496 [response to lipopolysaccharide] evidence: IEA
GeneID:1269 -> Biological process: GO:0033004 [negative regulation of mast cell activation] evidence: IEA
GeneID:1269 -> Biological process: GO:0045759 [negative regulation of action potential] evidence: IEA
GeneID:1269 -> Biological process: GO:0050728 [negative regulation of inflammatory response] evidence: IEA
GeneID:1269 -> Biological process: GO:0051001 [negative regulation of nitric-oxide synthase activity] evidence: IEA
GeneID:1269 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:1269 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
GeneID:1269 -> Cellular component: GO:0030425 [dendrite] evidence: IEA
GeneID:1269 -> Cellular component: GO:0031234 [extrinsic to internal side of plasma membrane] evidence: IEA
GeneID:1269 -> Cellular component: GO:0043204 [perikaryon] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.