Home |
Help |
Advanced search
2024-05-09 01:14:24, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001663 3939 bp mRNA linear PRI 02-JUN-2013
DEFINITION Homo sapiens ADP-ribosylation factor 6 (ARF6), mRNA.
ACCESSION NM_001663
VERSION NM_001663.3 GI:148283740
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3939)
AUTHORS Chen,P.W., Jian,X., Yoon,H.Y. and Randazzo,P.A.
TITLE ARAP2 signals through Arf6 and Rac1 to control focal adhesion
morphology
JOURNAL J. Biol. Chem. 288 (8), 5849-5860 (2013)
PUBMED 23295182
REMARK GeneRIF: ARAP2 signals through Arf6 and Rac1 to control focal
adhesion morphology
REFERENCE 2 (bases 1 to 3939)
AUTHORS Jayaram,B. and Kowluru,A.
TITLE Phagocytic NADPH oxidase links ARNO-Arf6 signaling pathway in
glucose-stimulated insulin secretion from the pancreatic beta-cell
JOURNAL Cell. Physiol. Biochem. 30 (6), 1351-1362 (2012)
PUBMED 23095975
REMARK GeneRIF: Arf6/ ARNO signaling mediates phospholipase-D, ERK1/2 and
cofilin activation in pancreatic beta-cells.
REFERENCE 3 (bases 1 to 3939)
AUTHORS Jung,J.J., Tiwari,A., Inamdar,S.M., Thomas,C.P., Goel,A. and
Choudhury,A.
TITLE Secretion of soluble vascular endothelial growth factor receptor 1
(sVEGFR1/sFlt1) requires Arf1, Arf6, and Rab11 GTPases
JOURNAL PLoS ONE 7 (9), E44572 (2012)
PUBMED 22962618
REMARK GeneRIF: Secretion of soluble vascular endothelial growth factor
receptor 1 (sVEGFR1/sFlt1) requires Arf1, Arf6, and Rab11 GTPases.
Erratum:[PLoS One. 2012;7(11).
doi:.1371/annotation/19ed28f9-9a01-4af9-857d-3ec4aaeceea1]
REFERENCE 4 (bases 1 to 3939)
AUTHORS Venkataraman,A., Nevrivy,D.J., Filtz,T.M. and Leid,M.
TITLE Grp1-associated scaffold protein (GRASP) is a regulator of the ADP
ribosylation factor 6 (Arf6)-dependent membrane trafficking pathway
JOURNAL Cell Biol. Int. 36 (12), 1115-1128 (2012)
PUBMED 22931251
REMARK GeneRIF: GRASP regulates the non-clathrin/Arf6-dependent, plasma
membrane recycling and signalling pathways.
REFERENCE 5 (bases 1 to 3939)
AUTHORS Kanamarlapudi,V., Owens,S.E., Saha,K., Pope,R.J. and Mundell,S.J.
TITLE ARF6-dependent regulation of P2Y receptor traffic and function in
human platelets
JOURNAL PLoS ONE 7 (8), E43532 (2012)
PUBMED 22916275
REMARK GeneRIF: Data describe a novel function of ARF6 in the
internalization of P2Y purinoceptors and demonstrate the integral
importance of this small GTPase upon platelet ADP receptor
function.
REFERENCE 6 (bases 1 to 3939)
AUTHORS D'Souza-Schorey,C. and Stahl,P.D.
TITLE Myristoylation is required for the intracellular localization and
endocytic function of ARF6
JOURNAL Exp. Cell Res. 221 (1), 153-159 (1995)
PUBMED 7589240
REFERENCE 7 (bases 1 to 3939)
AUTHORS D'Souza-Schorey,C., Li,G., Colombo,M.I. and Stahl,P.D.
TITLE A regulatory role for ARF6 in receptor-mediated endocytosis
JOURNAL Science 267 (5201), 1175-1178 (1995)
PUBMED 7855600
REFERENCE 8 (bases 1 to 3939)
AUTHORS Welsh,C.F., Moss,J. and Vaughan,M.
TITLE ADP-ribosylation factors: a family of approximately 20-kDa guanine
nucleotide-binding proteins that activate cholera toxin
JOURNAL Mol. Cell. Biochem. 138 (1-2), 157-166 (1994)
PUBMED 7898460
REFERENCE 9 (bases 1 to 3939)
AUTHORS Tsuchiya,M., Price,S.R., Tsai,S.C., Moss,J. and Vaughan,M.
TITLE Molecular identification of ADP-ribosylation factor mRNAs and their
expression in mammalian cells
JOURNAL J. Biol. Chem. 266 (5), 2772-2777 (1991)
PUBMED 1993656
REFERENCE 10 (bases 1 to 3939)
AUTHORS Stearns,T., Willingham,M.C., Botstein,D. and Kahn,R.A.
TITLE ADP-ribosylation factor is functionally and physically associated
with the Golgi complex
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (3), 1238-1242 (1990)
PUBMED 2105501
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AL121163.1, DA217686.1,
BC008918.2, BM838197.1 and BC030291.1.
On May 24, 2007 this sequence version replaced gi:6996000.
Summary: This gene encodes a member of the human ARF gene family,
which is part of the RAS superfamily. The ARF genes encode small
guanine nucleotide-binding proteins that stimulate the
ADP-ribosyltransferase activity of cholera toxin and play a role in
vesicular trafficking and as activators of phospholipase D. The
product of this gene is localized to the plasma membrane, and
regulates vesicular trafficking, remodelling of membrane lipids,
and signaling pathways that lead to actin remodeling. A pseudogene
of this gene is located on chromosome 7. [provided by RefSeq, Jul
2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AL121163.1, BC008918.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-37 AL121163.1 1-37
38-85 DA217686.1 34-81
86-1359 BC008918.2 1-1274
1360-1858 BM838197.1 19-517
1859-3939 BC030291.1 568-2648
FEATURES Location/Qualifiers
source 1..3939
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="14"
/map="14q21.3"
gene 1..3939
/gene="ARF6"
/note="ADP-ribosylation factor 6"
/db_xref="GeneID:382"
/db_xref="HGNC:659"
/db_xref="HPRD:02714"
/db_xref="MIM:600464"
exon 1..140
/gene="ARF6"
/inference="alignment:Splign:1.39.8"
misc_feature 1
/gene="ARF6"
/note="5'-most transcription initiation site"
variation 9
/gene="ARF6"
/replace="a"
/replace="t"
/db_xref="dbSNP:367624660"
variation 22
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:112027915"
misc_feature 31
/gene="ARF6"
/note="major transcription initiation site"
variation 118
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:117146976"
exon 141..3939
/gene="ARF6"
/inference="alignment:Splign:1.39.8"
variation 141
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:186296964"
variation 202
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:371561780"
variation 272
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:147968439"
variation 329
/gene="ARF6"
/replace=""
/replace="c"
/db_xref="dbSNP:35832046"
variation 353
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:377296430"
variation 396
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:112017635"
variation 422
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:59477608"
misc_feature 571..573
/gene="ARF6"
/note="upstream in-frame stop codon"
variation 588
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:201725640"
variation 600
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:375473057"
variation 611
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:368010518"
variation 615
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61758874"
CDS 622..1149
/gene="ARF6"
/codon_start=1
/product="ADP-ribosylation factor 6"
/protein_id="NP_001654.1"
/db_xref="GI:4502211"
/db_xref="CCDS:CCDS9695.1"
/db_xref="GeneID:382"
/db_xref="HGNC:659"
/db_xref="HPRD:02714"
/db_xref="MIM:600464"
/translation="
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
"
misc_feature 634..1137
/gene="ARF6"
/note="ADP ribosylation factor 6 (Arf6); Region: Arf6;
cd04149"
/db_xref="CDD:206716"
misc_feature 646..>1062
/gene="ARF6"
/note="GTPase SAR1 and related small G proteins [General
function prediction only]; Region: COG1100"
/db_xref="CDD:224025"
misc_feature 679..702
/gene="ARF6"
/note="G1 box; other site"
/db_xref="CDD:206716"
misc_feature order(685..690,700..702,712..714,748..771,835..837,
850..852)
/gene="ARF6"
/note="putative GAP interaction site [polypeptide
binding]; other site"
/db_xref="CDD:206716"
misc_feature order(688..705,742..744,751..753,817..819,985..990,
994..996,1084..1089)
/gene="ARF6"
/note="GTP/Mg2+ binding site [chemical binding]; other
site"
/db_xref="CDD:206716"
misc_feature 715..762
/gene="ARF6"
/note="Switch I region; other site"
/db_xref="CDD:206716"
misc_feature 730..735
/gene="ARF6"
/note="QS Arf6 conserved motif; other site"
/db_xref="CDD:206716"
misc_feature order(751..765,778..780,808..810,820..822,838..840,
844..852)
/gene="ARF6"
/note="putative GEF interaction site [polypeptide
binding]; other site"
/db_xref="CDD:206716"
misc_feature 751..753
/gene="ARF6"
/note="G2 box; other site"
/db_xref="CDD:206716"
misc_feature order(754..777,805..807,838..840,847..852)
/gene="ARF6"
/note="putative effector interaction site; other site"
/db_xref="CDD:206716"
misc_feature 760..807
/gene="ARF6"
/note="interswitch region; other site"
/db_xref="CDD:206716"
misc_feature 808..819
/gene="ARF6"
/note="G3 box; other site"
/db_xref="CDD:206716"
misc_feature 814..861
/gene="ARF6"
/note="Switch II region; other site"
/db_xref="CDD:206716"
misc_feature 985..996
/gene="ARF6"
/note="G4 box; other site"
/db_xref="CDD:206716"
misc_feature 1084..1092
/gene="ARF6"
/note="G5 box; other site"
/db_xref="CDD:206716"
STS 628..1520
/gene="ARF6"
/standard_name="ARF6_719"
/db_xref="UniSTS:277010"
variation 630
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61758873"
variation 638
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:61754358"
variation 645
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:140399482"
variation 664
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61754359"
variation 672
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:114513764"
variation 679
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:61755560"
variation 687
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61755561"
variation 693
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:373412874"
variation 702
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:200695445"
variation 744
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:61755562"
variation 774
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61755563"
variation 783
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61732572"
variation 793
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:376013488"
variation 802
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61755564"
variation 816
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61755565"
variation 835
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:61734985"
variation 840
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:111484414"
variation 864
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:141035771"
variation 873
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:61755566"
variation 876
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:145045252"
variation 919
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61755567"
variation 928
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:3100898"
variation 935
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61755568"
variation 948
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:117373659"
variation 963
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61755569"
variation 978
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:201401465"
variation 982
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61755570"
variation 1021
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61755571"
variation 1023
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:376018460"
variation 1048
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:61755572"
variation 1055
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61755573"
variation 1073
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:61755574"
variation 1092
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:138905564"
variation 1109
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:61755575"
variation 1110
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:140506930"
variation 1119
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:143656735"
variation 1122
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:372949566"
variation 1140
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:369105384"
variation 1158
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:373061714"
variation 1210
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:371978931"
variation 1230
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:190349237"
variation 1241
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:112211624"
variation 1267
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:181594154"
variation 1337
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:373961802"
variation 1338
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:368376617"
variation 1339..1340
/gene="ARF6"
/replace=""
/replace="tt"
/db_xref="dbSNP:138800769"
variation 1359
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:61983787"
variation 1359
/gene="ARF6"
/replace=""
/replace="t"
/replace="tt"
/db_xref="dbSNP:35848359"
STS 1387..1557
/gene="ARF6"
/standard_name="SHGC-2638"
/db_xref="UniSTS:68266"
variation 1505
/gene="ARF6"
/replace="a"
/replace="t"
/db_xref="dbSNP:15382"
variation 1584
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:15381"
polyA_site 1652
/gene="ARF6"
polyA_site 1657
/gene="ARF6"
variation 1662
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:72680046"
variation 1750
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:186566342"
variation 1790
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:190843251"
variation 1861
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:55668293"
variation 1889
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:182367262"
variation 1896
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:185946318"
variation 1919
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:190716215"
variation 2081
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:183371046"
variation 2083
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:187956517"
variation 2332
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:117302051"
variation 2350
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:145059127"
variation 2412..2414
/gene="ARF6"
/replace=""
/replace="aaa"
/db_xref="dbSNP:3217662"
variation 2413..2415
/gene="ARF6"
/replace=""
/replace="aat"
/db_xref="dbSNP:369138632"
polyA_signal 2416..2421
/gene="ARF6"
variation 2441
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:192253781"
polyA_site 2444
/gene="ARF6"
variation 2457
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:182736285"
variation 2503
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:187777195"
variation 2531
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:75618848"
STS 2814..2917
/gene="ARF6"
/standard_name="SHGC-64115"
/db_xref="UniSTS:48227"
variation 2841
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:1064615"
variation 2871
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:192393000"
variation 2882
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:140339761"
variation 2886
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:11552919"
variation 2926
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:375413551"
variation 3001
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:112755109"
STS 3062..3178
/gene="ARF6"
/standard_name="D14S793"
/db_xref="UniSTS:153530"
variation 3093
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:369469022"
variation 3113
/gene="ARF6"
/replace="a"
/replace="t"
/db_xref="dbSNP:114990188"
variation 3218
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:375906435"
variation 3229
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:141442870"
variation 3284
/gene="ARF6"
/replace="c"
/replace="t"
/db_xref="dbSNP:184420714"
variation 3371
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:138151813"
variation 3405
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:11552918"
variation 3424
/gene="ARF6"
/replace="a"
/replace="g"
/db_xref="dbSNP:373024767"
variation 3526
/gene="ARF6"
/replace="c"
/replace="g"
/db_xref="dbSNP:140492524"
STS 3527..3677
/gene="ARF6"
/standard_name="SHGC-64342"
/db_xref="UniSTS:9452"
variation 3587
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:200515021"
variation 3707
/gene="ARF6"
/replace="g"
/replace="t"
/db_xref="dbSNP:369073621"
STS 3722..3906
/gene="ARF6"
/standard_name="RH80260"
/db_xref="UniSTS:85506"
variation 3845..3846
/gene="ARF6"
/replace=""
/replace="c"
/db_xref="dbSNP:35091979"
polyA_signal 3918..3923
/gene="ARF6"
variation 3932
/gene="ARF6"
/replace="a"
/replace="c"
/db_xref="dbSNP:3179189"
polyA_site 3939
/gene="ARF6"
ORIGIN
ggtcggcctctgctgcgcctgcgtggtcgggaggggaagtgaggcggtttcctcggcgccttttccggcagcggcggcggcagaactgggaggaggagttggaggccggagggagcccgcgctcggggcggcggctggaggcagcgcaccgagttcccgcgaggatccatgacctgacggggccccggagccgcgctgcctctcgggtgtcctgggtcggtggggagcccagtgctcgcaggccggcgggcgggccggagggctgcagtctccctcgcggtgagaggaaggcggaggagcgggaaccgcggcggcgctcgcgcggcgcctgcggggggaagggcagttccgggccgggccgcgcctcagcagggcggcggctcccagcgcagtctcagggcccgggtggcggcggcgactggagaaatcaagttgtgcggtcggtgatgcccgagtgagcggggggcctgggcctctgcccttaggaggcaactcccacgcaggccgcaaaggcgctctcgcggccgagaggcttcgtttcggtttcgcggcggcggcggcgttgttggctgaggggacccgggacacctgaatgcccccggccccggctcctccgacgcgatggggaaggtgctatccaaaatcttcgggaacaaggaaatgcggatcctcatgttgggcctggacgcggccggcaagacaacaatcctgtacaagttgaagctgggccagtcggtgaccaccattcccactgtgggtttcaacgtggagacggtgacttacaaaaatgtcaagttcaacgtatgggatgtgggcggccaggacaagatccggccgctctggcggcattactacactgggacccaaggtctcatcttcgtagtggactgcgccgaccgcgaccgcatcgatgaggctcgccaggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttcgccaacaagcaggacctgcccgatgccatgaaaccccacgagatccaggagaaactgggcctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcaggggacggactctatgaggggctcacatggttaacctctaactacaaatcttaatgagcattctccacccatcccctggaaggagagaaatcaaaaacccattcataggattatcgccaccatcacctctttcaattgccactttctcttcttttgaatttgaactctggagttactgttctacagtttggcggggacggggcttgggggttttctcttttgtttgtttccctttctttttccttttttttttttttttttttttgttggctttgcgttaggatgctctgatctgacatttgacatgaacacaaagttgctagatgctcttgttgacttccagcagatgggatgggggaaacacagcagttcttggtaaagtcctttgtaataatagtttgatttttttatttcgagagaatctttcattttcctatgtatgcttttttccttttttgcccagtttccttatcacttgctgtagatggcttattttgcattcatgcagactatgttgcaagtctgtttcatctagtaaactgaaaattattgcttaatcaaactgccgtttgtcttttatatttaaggccttccccccccttccttatgagttctaacttagtaatttcaaatgtgaccttttatatctaagaccagtatagtaaacttagcccacagtggcaaataatgagtaatattgtaatatgttccagttgcacctcagtatgttaaacaggtaatgtaagaagttctctgaaatgtcagcaagtaagttctgaaacacatcatgcatgagtaggaataaaacccaagttccccataacgtagataacttaatgctgcataaaaatatgaaagtgtaacccatgaaggacactttttctttccactgcaaagttagccactttgctgtttttcctcttttttaaactttgaaaatagactctttccagaaattggagcaataatggtgttaccacacacagattaaataatttgtagatattttaagtgacttttgggcaaaactggaatgtatacttttaccttgtttcaaacacctaagaccagtaatttaaaaattactaaaaggtttactttgttcattaataaaacatttaacaattcaaattatatgcaccttttacctagttgaaaaaaatacacattcctgttttcacattatagcaactgattaagctgaagctgtaagtcattttttatagatgagtgatccgcatctccatcaattagaacactggaaaagatgttttataaaagaggtatttaattttgtttgtaggattaactcatgcaaataataaaaaagatatcctgttggttcaatagtacactgtctcctttaaggaaggaagcgtgatgaatgaatgatgtgtagacttgagggatgactattaaaggggacgtaggatgaagagaaagaacctacagatgacaatgaatgtaaacttatttttcttcatgtgtaagcagtgtgctcgctggtgatatccagatcctaacaagattacttggttagctggttaggaccagtaactggattgcgaccactatgataatattttgaaccaaatgttaatgcttgatgcagaattgtaaagcagcatctggttcctatatagccttaaggattaattttagtgatcctcaaggaattaaatagggaatttcagaaatgtagactgcaaaggcagtatacaggaaaaggtggagtgggttttgtttatgagggtgtctgaaaactaaaattgagcgggatatcatggtatagttggacagtattggtccttcacactttggccatattgtataatggagcttttaccaaagatgtatgagaagtgtaagactataaaaaaatgaactattcaaagtaaaactcttaacaaacattttacttaaagcagatgcaaaagggtattctcatgtaggctcctgttggtgcagagggatttttttgatttcaggatacaactaaagtacgaagttctcagtttcactttagtagaaagagctctagaaatgaggctgataaacacatctaagaacactggttgctttctaaaatttccaaagctccaccataaatgtaatttttagtgtttcaaatgattgcattttaaagtatataaatatgggttatccaatatcaatgctatagtaacatcctgaaacaaaacaagcacaaaggtataaatgcctaaactggaggaaacttgaaaccctcatgttaaatcttaaatgtagtatttctaacttgtgaagacagattggtaggcagccatttttttgtgtcttaaaataactgggggcatagttaaaattttatacatcaagtgattgctattattgaatgttgcaggtgagatgtggttatttttagtttatttgaaatgtttgactggaaaggggggagggggaagcaaatatttgaaatttggaaaaccctaaaccttttggtaagaaattgtaattttcacttaaaattttctttaaggatataagaggtttataattgatgtagttaaattgaacaataaccattggtgactggagcaggtaattatagcctgcagaaaaaattatctaagaattttaaaaataagatcctgaagttgtttaattgcatccatttctgtatttatgtgaatttataaactgcagtaagttttgaatgaggttaatcttgtttaatataagtaaatgagtctgtagactgtgatctccccaaactaaaaagtacagtacttggaattgtgttctttatggttgtagtgttggtaaagcactaatatgcagaaaataaaggaattacacagtgca
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:382 -> Molecular function: GO:0003924 [GTPase activity] evidence: TAS
GeneID:382 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:382 -> Molecular function: GO:0005525 [GTP binding] evidence: TAS
GeneID:382 -> Molecular function: GO:0031996 [thioesterase binding] evidence: IPI
GeneID:382 -> Biological process: GO:0001889 [liver development] evidence: IEA
GeneID:382 -> Biological process: GO:0006184 [GTP catabolic process] evidence: TAS
GeneID:382 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:382 -> Biological process: GO:0006928 [cellular component movement] evidence: TAS
GeneID:382 -> Biological process: GO:0007155 [cell adhesion] evidence: TAS
GeneID:382 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: IEA
GeneID:382 -> Biological process: GO:0015031 [protein transport] evidence: IEA
GeneID:382 -> Biological process: GO:0016192 [vesicle-mediated transport] evidence: TAS
GeneID:382 -> Biological process: GO:0030838 [positive regulation of actin filament polymerization] evidence: IMP
GeneID:382 -> Biological process: GO:0030866 [cortical actin cytoskeleton organization] evidence: IMP
GeneID:382 -> Biological process: GO:0031529 [ruffle organization] evidence: IDA
GeneID:382 -> Biological process: GO:0034394 [protein localization to cell surface] evidence: ISS
GeneID:382 -> Biological process: GO:0035020 [regulation of Rac protein signal transduction] evidence: IDA
GeneID:382 -> Biological process: GO:0048261 [negative regulation of receptor-mediated endocytosis] evidence: TAS
GeneID:382 -> Biological process: GO:0051489 [regulation of filopodium assembly] evidence: IDA
GeneID:382 -> Biological process: GO:0060998 [regulation of dendritic spine development] evidence: ISS
GeneID:382 -> Biological process: GO:0090004 [positive regulation of establishment of protein localization to plasma membrane] evidence: ISS
GeneID:382 -> Biological process: GO:0090162 [establishment of epithelial cell polarity] evidence: IEA
GeneID:382 -> Cellular component: GO:0001726 [ruffle] evidence: IDA
GeneID:382 -> Cellular component: GO:0005768 [endosome] evidence: IDA
GeneID:382 -> Cellular component: GO:0005768 [endosome] evidence: TAS
GeneID:382 -> Cellular component: GO:0005769 [early endosome] evidence: IEA
GeneID:382 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA
GeneID:382 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
GeneID:382 -> Cellular component: GO:0005938 [cell cortex] evidence: IDA
GeneID:382 -> Cellular component: GO:0010008 [endosome membrane] evidence: IEA
GeneID:382 -> Cellular component: GO:0016020 [membrane] evidence: TAS
GeneID:382 -> Cellular component: GO:0030139 [endocytic vesicle] evidence: IDA
GeneID:382 -> Cellular component: GO:0031527 [filopodium membrane] evidence: IDA
GeneID:382 -> Cellular component: GO:0055037 [recycling endosome] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001654 -> EC 3.6.5.1
NP_001654 -> EC 3.6.5.2
NP_001654 -> EC 3.6.5.3
NP_001654 -> EC 3.6.5.4
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.