Home |
Help |
Advanced search
2024-04-25 17:50:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001568 1516 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens eukaryotic translation initiation factor 3, subunit E
(EIF3E), mRNA.
ACCESSION NM_001568
VERSION NM_001568.2 GI:83656779
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1516)
AUTHORS Mocquet,V., Neusiedler,J., Rende,F., Cluet,D., Robin,J.P.,
Terme,J.M., Duc Dodon,M., Wittmann,J., Morris,C., Le Hir,H.,
Ciminale,V. and Jalinot,P.
TITLE The human T-lymphotropic virus type 1 tax protein inhibits
nonsense-mediated mRNA decay by interacting with INT6/EIF3E and
UPF1
JOURNAL J. Virol. 86 (14), 7530-7543 (2012)
PUBMED 22553336
REMARK GeneRIF: HTLV-1Tax binds both INT6 and UPF1. The analysis of Tax
mutants indicated that the Tax-INT6 association is necessary for
nonsense-mediated mRNA decay inhibition, and data suggest that Tax
sequesters INT6 out of reach from UPF1.
REFERENCE 2 (bases 1 to 1516)
AUTHORS Neusiedler,J., Mocquet,V., Limousin,T., Ohlmann,T., Morris,C. and
Jalinot,P.
TITLE INT6 interacts with MIF4GD/SLIP1 and is necessary for efficient
histone mRNA translation
JOURNAL RNA 18 (6), 1163-1177 (2012)
PUBMED 22532700
REMARK GeneRIF: INT6 and MIF4GD were observed to colocalize in cytoplasmic
foci. It was concluded that INT6, by establishing interactions with
MIF4GD and SLBP, plays an important role in translation of poly(A)
minus histone mRNAs.
REFERENCE 3 (bases 1 to 1516)
AUTHORS Morris,C., Tomimatsu,N., Richard,D.J., Cluet,D., Burma,S.,
Khanna,K.K. and Jalinot,P.
TITLE INT6/EIF3E interacts with ATM and is required for proper execution
of the DNA damage response in human cells
JOURNAL Cancer Res. 72 (8), 2006-2016 (2012)
PUBMED 22508697
REMARK GeneRIF: findings reveal unexpected and striking connections of
INT6 with ATM and BRCA1
REFERENCE 4 (bases 1 to 1516)
AUTHORS Dolmans GH, Werker PM, Hennies HC, Furniss D, Festen EA, Franke L,
Becker K, van der Vlies P, Wolffenbuttel BH, Tinschert S, Toliat
MR, Nothnagel M, Franke A, Klopp N, Wichmann HE, Nurnberg P, Giele
H, Ophoff RA and Wijmenga C.
CONSRTM Dutch Dupuytren Study Group; German Dupuytren Study Group;
LifeLines Cohort Study; BSSH-GODD Consortium
TITLE Wnt signaling and Dupuytren's disease
JOURNAL N. Engl. J. Med. 365 (4), 307-317 (2011)
PUBMED 21732829
REFERENCE 5 (bases 1 to 1516)
AUTHORS Suo,J., Snider,S.J., Mills,G.B., Creighton,C.J., Chen,A.C.,
Schiff,R., Lloyd,R.E. and Chang,E.C.
TITLE Int6 regulates both proteasomal degradation and translation
initiation and is critical for proper formation of acini by human
mammary epithelium
JOURNAL Oncogene 30 (6), 724-736 (2011)
PUBMED 20890303
REMARK GeneRIF: Int6 depletion blocks ubiquitin-dependent proteolysis by
decreasing both ubiquitin levels and the assembly of functional
proteasome machinery, leading to accumulation of oncoproteins, such
as SRC3.
REFERENCE 6 (bases 1 to 1516)
AUTHORS Miyazaki,S., Imatani,A., Ballard,L., Marchetti,A., Buttitta,F.,
Albertsen,H., Nevanlinna,H.A., Gallahan,D. and Callahan,R.
TITLE The chromosome location of the human homolog of the mouse mammary
tumor-associated gene INT6 and its status in human breast
carcinomas
JOURNAL Genomics 46 (1), 155-158 (1997)
PUBMED 9403073
REFERENCE 7 (bases 1 to 1516)
AUTHORS Asano,K., Merrick,W.C. and Hershey,J.W.
TITLE The translation initiation factor eIF3-p48 subunit is encoded by
int-6, a site of frequent integration by the mouse mammary tumor
virus genome
JOURNAL J. Biol. Chem. 272 (38), 23477-23480 (1997)
PUBMED 9295280
REFERENCE 8 (bases 1 to 1516)
AUTHORS Methot,N., Rom,E., Olsen,H. and Sonenberg,N.
TITLE The human homologue of the yeast Prt1 protein is an integral part
of the eukaryotic initiation factor 3 complex and interacts with
p170
JOURNAL J. Biol. Chem. 272 (2), 1110-1116 (1997)
PUBMED 8995410
REFERENCE 9 (bases 1 to 1516)
AUTHORS Asano,K., Kinzy,T.G., Merrick,W.C. and Hershey,J.W.
TITLE Conservation and diversity of eukaryotic translation initiation
factor eIF3
JOURNAL J. Biol. Chem. 272 (2), 1101-1109 (1997)
PUBMED 8995409
REFERENCE 10 (bases 1 to 1516)
AUTHORS Desbois,C., Rousset,R., Bantignies,F. and Jalinot,P.
TITLE Exclusion of Int-6 from PML nuclear bodies by binding to the HTLV-I
Tax oncoprotein
JOURNAL Science 273 (5277), 951-953 (1996)
PUBMED 8688078
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. This record has been curated by NCBI staff in
collaboration with Francesco Amaldi. The reference sequence was
derived from BG498300.1 and U62962.1.
On Dec 15, 2005 this sequence version replaced gi:4503520.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U62962.1, BC016706.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-7 BG498300.1 2-8
8-1516 U62962.1 2-1510
FEATURES Location/Qualifiers
source 1..1516
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="8"
/map="8q22-q23"
gene 1..1516
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/note="eukaryotic translation initiation factor 3, subunit
E"
/db_xref="GeneID:3646"
/db_xref="HGNC:3277"
/db_xref="HPRD:03734"
/db_xref="MIM:602210"
exon 1..118
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
misc_feature 1
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/note="5'-most of multiple alternative transcription
initiation sites"
misc_feature 14
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/note="predominant transcription initiation site"
CDS 29..1366
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/note="eukaryotic translation initiation factor 3, subunit
6 (48kD); eukaryotic translation initiation factor 3,
subunit 6 48kDa; murine mammary tumor integration site 6
(oncogene homolog); mammary tumor-associated protein INT6;
eIF-3 p48; viral integration site protein INT-6 homolog;
eukaryotic translation initiation factor 3 subunit 6"
/codon_start=1
/product="eukaryotic translation initiation factor 3
subunit E"
/protein_id="NP_001559.1"
/db_xref="GI:4503521"
/db_xref="CCDS:CCDS6308.1"
/db_xref="GeneID:3646"
/db_xref="HGNC:3277"
/db_xref="HPRD:03734"
/db_xref="MIM:602210"
/translation="
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
"
misc_feature 32..34
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylalanine; propagated from
UniProtKB/Swiss-Prot (P60228.1); acetylation site"
misc_feature 38..412
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P60228.1);
Region: Sufficient for interaction with EPAS1"
misc_feature 41..442
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/note="eIF3 subunit 6 N terminal domain; Region: eIF3_N;
pfam09440"
/db_xref="CDD:220243"
misc_feature 53..613
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P60228.1);
Region: Sufficient for interaction with TRIM27"
misc_feature 902..1207
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/note="PCI domain; Region: PCI; pfam01399"
/db_xref="CDD:216479"
misc_feature 1079..1363
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P60228.1);
Region: Sufficient for interaction with MCM7"
misc_feature 1223..1225
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P60228.1); phosphorylation site"
variation 65
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/replace="c"
/replace="t"
/db_xref="dbSNP:1052818"
STS 100..201
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="A002C29"
/db_xref="UniSTS:21573"
STS 100..201
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="G19931"
/db_xref="UniSTS:21572"
exon 119..233
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
exon 234..351
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
STS 308..564
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="REN32267"
/db_xref="UniSTS:357067"
exon 352..394
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
STS 379..467
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="RH44515"
/db_xref="UniSTS:53151"
exon 395..499
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
exon 500..625
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
STS 556..829
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="REN32268"
/db_xref="UniSTS:357068"
variation 558
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/replace="c"
/replace="t"
/db_xref="dbSNP:11552793"
exon 626..750
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
exon 751..877
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
STS 822..1360
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="ECD12775"
/db_xref="UniSTS:293807"
exon 878..979
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
exon 980..1089
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
exon 1090..1192
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
STS 1145..1369
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="D6S1876"
/db_xref="UniSTS:68852"
exon 1193..1327
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
STS 1296..1460
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/standard_name="RH27221"
/db_xref="UniSTS:90229"
exon 1328..1508
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
/inference="alignment:Splign:1.39.8"
polyA_signal 1489..1494
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
polyA_site 1508
/gene="EIF3E"
/gene_synonym="eIF3-p46; EIF3-P48; EIF3S6; INT6"
ORIGIN
gagcacagactcccttttctttggcaagatggcggagtacgacttgactactcgcatcgcgcactttttggatcggcatctagtctttccgcttcttgaatttctctctgtaaaggagatatataatgaaaaggaattattacaaggtaaattggaccttcttagtgataccaacatggtagactttgctatggatgtatacaaaaacctttattctgatgatattcctcatgctttgagagagaaaagaaccacagtggttgcacaactgaaacagcttcaggcagaaacagaaccaattgtgaagatgtttgaagatccagaaactacaaggcaaatgcagtcaaccagggatggtaggatgctctttgactacctggcggacaagcatggttttaggcaggaatatttagatacactctacagatatgcaaaattccagtacgaatgtgggaattactcaggagcagcagaatatctttatttttttagagtgctggttccagcaacagatagaaatgctttaagttcactctggggaaagctggcctctgaaatcttaatgcagaattgggatgcagccatggaagaccttacacggttaaaagagaccatagataataattctgtgagttctccacttcagtctcttcagcagagaacatggctcattcactggtctctgtttgttttcttcaatcaccccaaaggtcgcgataatattattgacctcttcctttatcagccacaatatcttaatgcaattcagacaatgtgtccacacattcttcgctatttgactacagcagtcataacaaacaaggatgttcgaaaacgtcggcaggttctaaaagatctagttaaagttattcaacaggagtcttacacatataaagacccaattacagaatttgttgaatgtttatatgttaactttgactttgatggggctcagaaaaagctgagggaatgtgaatcagtgcttgtgaatgacttcttcttggtggcttgtcttgaggatttcattgaaaatgcccgtctcttcatatttgagactttctgtcgcatccaccagtgtatcagcattaacatgttggcagataaattgaacatgactccagaagaagctgaaaggtggattgtaaatttgattagaaatgcaagactggatgccaagattgattctaaattaggtcatgtggttatgggtaacaatgcagtctcaccctatcagcaagtgattgaaaagaccaaaagcctttcctttagaagccagatgttggccatgaatattgagaagaaacttaatcagaatagcaggtcagaggctcctaactgggcaactcaagattctggcttctactgaagaaccataaagaaaagatgaaaaaaaaaactatcaaagaaagatgaaataataaaactattatataaagggtgacttacattttggaaacaacatattacgtataaattttgaagaattggaataaaattgattcattttaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3646 -> Molecular function: GO:0003743 [translation initiation factor activity] evidence: IC
GeneID:3646 -> Molecular function: GO:0003743 [translation initiation factor activity] evidence: IDA
GeneID:3646 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:3646 -> Molecular function: GO:0047485 [protein N-terminus binding] evidence: IPI
GeneID:3646 -> Biological process: GO:0000184 [nuclear-transcribed mRNA catabolic process, nonsense-mediated decay] evidence: IMP
GeneID:3646 -> Biological process: GO:0001731 [formation of translation preinitiation complex] evidence: IEA
GeneID:3646 -> Biological process: GO:0006412 [translation] evidence: TAS
GeneID:3646 -> Biological process: GO:0006413 [translational initiation] evidence: IC
GeneID:3646 -> Biological process: GO:0006413 [translational initiation] evidence: IDA
GeneID:3646 -> Biological process: GO:0006413 [translational initiation] evidence: TAS
GeneID:3646 -> Biological process: GO:0006446 [regulation of translational initiation] evidence: NAS
GeneID:3646 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:3646 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
GeneID:3646 -> Biological process: GO:0045947 [negative regulation of translational initiation] evidence: NAS
GeneID:3646 -> Cellular component: GO:0000785 [chromatin] evidence: NAS
GeneID:3646 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:3646 -> Cellular component: GO:0005654 [nucleoplasm] evidence: NAS
GeneID:3646 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:3646 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:3646 -> Cellular component: GO:0005852 [eukaryotic translation initiation factor 3 complex] evidence: IDA
GeneID:3646 -> Cellular component: GO:0005852 [eukaryotic translation initiation factor 3 complex] evidence: NAS
GeneID:3646 -> Cellular component: GO:0016282 [eukaryotic 43S preinitiation complex] evidence: IEA
GeneID:3646 -> Cellular component: GO:0016605 [PML body] evidence: IDA
GeneID:3646 -> Cellular component: GO:0033290 [eukaryotic 48S preinitiation complex] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.