2024-04-20 05:44:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001278500 2430 bp mRNA linear PRI 22-JUN-2013 DEFINITION Homo sapiens adenosine A2a receptor (ADORA2A), transcript variant 5, mRNA. ACCESSION NM_001278500 VERSION NM_001278500.1 GI:511772971 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2430) AUTHORS Li,J., Jonsson,A.L., Beuming,T., Shelley,J.C. and Voth,G.A. TITLE Ligand-Dependent Activation and Deactivation of the Human Adenosine A2A Receptor JOURNAL J. Am. Chem. Soc. 135 (23), 8749-8759 (2013) PUBMED 23678995 REFERENCE 2 (bases 1 to 2430) AUTHORS Chan,E.S., Liu,H., Fernandez,P., Luna,A., Perez-Aso,M., Bujor,A.M., Trojanowska,M. and Cronstein,B.N. TITLE Adenosine A2A receptors promote collagen production by a Fli1- and CTGF-mediated mechanism JOURNAL Arthritis Res. Ther. 15 (3), R58 (2013) PUBMED 23663495 REMARK Publication Status: Available-Online prior to print REFERENCE 3 (bases 1 to 2430) AUTHORS Lebon,G., Warne,T., Edwards,P.C., Bennett,K., Langmead,C.J., Leslie,A.G. and Tate,C.G. TITLE Agonist-bound adenosine A2A receptor structures reveal common features of GPCR activation JOURNAL Nature 474 (7352), 521-525 (2011) PUBMED 21593763 REMARK GeneRIF: crystal structures of the thermostabilized human adenosine A(2A) receptor (A(2A)R-GL31) bound to its endogenous agonist adenosine and the synthetic agonist NECA Publication Status: Online-Only REFERENCE 4 (bases 1 to 2430) AUTHORS Xu,F., Wu,H., Katritch,V., Han,G.W., Jacobson,K.A., Gao,Z.G., Cherezov,V. and Stevens,R.C. TITLE Structure of an agonist-bound human A2A adenosine receptor JOURNAL Science 332 (6027), 322-327 (2011) PUBMED 21393508 REMARK GeneRIF: study reports the crystal structure of the A(2A) adenosine receptor bound to an agonist UK-432097 at 2.7 angstrom resolution REFERENCE 5 (bases 1 to 2430) AUTHORS Jaakola,V.P., Griffith,M.T., Hanson,M.A., Cherezov,V., Chien,E.Y., Lane,J.R., Ijzerman,A.P. and Stevens,R.C. TITLE The 2.6 angstrom crystal structure of a human A2A adenosine receptor bound to an antagonist JOURNAL Science 322 (5905), 1211-1217 (2008) PUBMED 18832607 REFERENCE 6 (bases 1 to 2430) AUTHORS Le,F., Townsend-Nicholson,A., Baker,E., Sutherland,G.R. and Schofield,P.R. TITLE Characterization and chromosomal localization of the human A2a adenosine receptor gene: ADORA2A JOURNAL Biochem. Biophys. Res. Commun. 223 (2), 461-467 (1996) PUBMED 8670304 REFERENCE 7 (bases 1 to 2430) AUTHORS MacCollin,M., Peterfreund,R., MacDonald,M., Fink,J.S. and Gusella,J. TITLE Mapping of a human A2a adenosine receptor (ADORA2) to chromosome 22 JOURNAL Genomics 20 (2), 332-333 (1994) PUBMED 8020991 REFERENCE 8 (bases 1 to 2430) AUTHORS Makujina,S.R., Sabouni,M.H., Bhatia,S., Douglas,F.L. and Mustafa,S.J. TITLE Vasodilatory effects of adenosine A2 receptor agonists CGS 21680 and CGS 22492 in human vasculature JOURNAL Eur. J. Pharmacol. 221 (2-3), 243-247 (1992) PUBMED 1426003 REFERENCE 9 (bases 1 to 2430) AUTHORS Furlong,T.J., Pierce,K.D., Selbie,L.A. and Shine,J. TITLE Molecular characterization of a human brain adenosine A2 receptor JOURNAL Brain Res. Mol. Brain Res. 15 (1-2), 62-66 (1992) PUBMED 1331670 REFERENCE 10 (bases 1 to 2430) AUTHORS Libert,F., Passage,E., Parmentier,M., Simons,M.J., Vassart,G. and Mattei,M.G. TITLE Chromosomal mapping of A1 and A2 adenosine receptors, VIP receptor, and a new subtype of serotonin receptor JOURNAL Genomics 11 (1), 225-227 (1991) PUBMED 1662665 REMARK Erratum:[Genomics 1994 Sep 1;23(1):305] COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA781734.1, CR456367.1, BG686029.1, HY249059.1 and CA307692.1. Summary: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein, an adenosine receptor of A2A subtype, uses adenosine as the preferred endogenous agonist and preferentially interacts with the G(s) and G(olf) family of G proteins to increase intracellular cAMP levels. It plays an important role in many biological functions, such as cardiac rhythm and circulation, cerebral and renal blood flow, immune function, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as inflammatory diseases and neurodegenerative disorders. Alternative splicing results in multiple transcript variants. A read-through transcript composed of the upstream SPECC1L (sperm antigen with calponin homology and coiled-coil domains 1-like) and ADORA2A (adenosine A2a receptor) gene sequence has been identified, but it is thought to be non-coding. [provided by RefSeq, Jun 2013]. Transcript Variant: This variant (5) differs in the 5' UTR compared to variant 1. Variants, 1, 2, 3, 4, and 5 encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## CDS exon combination :: BC013780.1, M97370.1 [ECO:0000331] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-569 DA781734.1 1-569 570-1388 CR456367.1 410-1228 1389-1819 BG686029.1 293-723 1820-2247 HY249059.1 1-428 c 2248-2430 CA307692.1 1-183 c FEATURES Location/Qualifiers source 1..2430 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="22" /map="22q11.23" gene 1..2430 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /note="adenosine A2a receptor" /db_xref="GeneID:135" /db_xref="HGNC:263" /db_xref="MIM:102776" exon 1..32 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /inference="alignment:Splign:1.39.8" exon 33..638 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /inference="alignment:Splign:1.39.8" misc_feature 283..285 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /note="upstream in-frame stop codon" CDS 307..1545 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /note="adenosine receptor subtype A2a" /codon_start=1 /product="adenosine receptor A2a" /protein_id="NP_001265429.1" /db_xref="GI:511772972" /db_xref="GeneID:135" /db_xref="HGNC:263" /db_xref="MIM:102776" /translation="
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
" misc_feature 328..402 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); transmembrane region" misc_feature 391..1170 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /note="7 transmembrane receptor (rhodopsin family); Region: 7tm_1; pfam00001" /db_xref="CDD:215646" misc_feature 433..504 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); transmembrane region" misc_feature 538..606 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); transmembrane region" misc_feature 667..735 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); transmembrane region" misc_feature 808..837 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); Region: Agonist binding" misc_feature 826..900 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); transmembrane region" misc_feature 1009..1080 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); transmembrane region" misc_feature 1042..1065 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); Region: Agonist binding" misc_feature 1096..1128 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); Region: Agonist binding" misc_feature 1105..1176 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29274.2); transmembrane region" exon 639..2416 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /inference="alignment:Splign:1.39.8" STS 1554..1883 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /standard_name="D22S1263" /db_xref="UniSTS:52178" STS 1652..1842 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /standard_name="ADORA2A" /db_xref="UniSTS:480136" STS 1724..1976 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" /standard_name="WI-18996" /db_xref="UniSTS:40515" polyA_signal 2372..2377 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" polyA_site 2399 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" polyA_site 2416 /gene="ADORA2A" /gene_synonym="A2aR; ADORA2; RDC8" ORIGIN
gactcccaggcccgaggactcctggaagggaggtgcctcaggaaccctgaagctgggctgagccatgatgctgctgccagaacccctgcagagggcctggtttcaggagactcagagtcctctgtgaaaaagcccttggagagcgccccagcagggctgcacttggctcctgtgaggaaggggctcaggggtctgggcccctccgcctgggccgggctgggagccaggcgggcggctgggctgcagcaatggaccgtgagctggcccagcccgcgtccgtgctgagcctgcctgtcgtctgtggccatgcccatcatgggctcctcggtgtacatcacggtggagctggccattgctgtgctggccatcctgggcaatgtgctggtgtgctgggccgtgtggctcaacagcaacctgcagaacgtcaccaactactttgtggtgtcactggcggcggccgacatcgcagtgggtgtgctcgccatcccctttgccatcaccatcagcaccgggttctgcgctgcctgccacggctgcctcttcattgcctgcttcgtcctggtcctcacgcagagctccatcttcagtctcctggccatcgccattgaccgctacattgccatccgcatcccgctccggtacaatggcttggtgaccggcacgagggctaagggcatcattgccatctgctgggtgctgtcgtttgccatcggcctgactcccatgctaggttggaacaactgcggtcagccaaaggagggcaagaaccactcccagggctgcggggagggccaagtggcctgtctctttgaggatgtggtccccatgaactacatggtgtacttcaacttctttgcctgtgtgctggtgcccctgctgctcatgctgggtgtctatttgcggatcttcctggcggcgcgacgacagctgaagcagatggagagccagcctctgccgggggagcgggcacggtccacactgcagaaggaggtccatgctgccaagtcactggccatcattgtggggctctttgccctctgctggctgcccctacacatcatcaactgcttcactttcttctgccccgactgcagccacgcccctctctggctcatgtacctggccatcgtcctctcccacaccaattcggttgtgaatcccttcatctacgcctaccgtatccgcgagttccgccagaccttccgcaagatcattcgcagccacgtcctgaggcagcaagaacctttcaaggcagctggcaccagtgcccgggtcttggcagctcatggcagtgacggagagcaggtcagcctccgtctcaacggccacccgccaggagtgtgggccaacggcagtgctccccaccctgagcggaggcccaatggctatgccctggggctggtgagtggagggagtgcccaagagtcccaggggaacacgggcctcccagacgtggagctccttagccatgagctcaagggagtgtgcccagagccccctggcctagatgaccccctggcccaggatggagcaggagtgtcctgatgattcatggagtttgccccttcctaagggaaggagatctttatctttctggttggcttgaccagtcacgttgggagaagagagagagtgccaggagaccctgagggcagccggttcctactttggactgagagaagggagccccaggctggagcagcatgaggcccagcaagaagggcttgggttctgaggaagcagatgtttcatgctgtgaggccttgcaccaggtgggggccacagcaccagcagcatctttgctgggcagggcccagccctccactgcagaagcatctggaagcaccaccttgtctccacagagcagcttgggcacagcagactggcctggccctgagactggggagtggctccaacagcctcctgccacccacacaccactctccctagactctcctagggttcaggagctgctgggcccagaggtgacatttgacttttttccaggaaaaatgtaagtgtgaggaaaccctttttattttattacctttcactctctggctgctgggtctgccgtcggtcctgctgctaacctggcaccagagcctctgcccggggagcctcaggcagtcctctcctgctgtcacagctgccatccacttctcagtcccagggccatctcttggagtgacaaagctgggatcaaggacagggagttgtaacagagcagtgccagagcatgggcccaggtcccaggggagaggttggggctggcaggccactggcatgtgctgagtagcgcagagctacccagtgagaggccttgtctaactgcctttccttctaaagggaatgtttttttctgagataaaataaaaacgagccacatcgtgttttaagcttgtccaaatgagaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:135 -> Molecular function: GO:0001609 [G-protein coupled adenosine receptor activity] evidence: IEA GeneID:135 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:135 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI GeneID:135 -> Molecular function: GO:0031802 [type 5 metabotropic glutamate receptor binding] evidence: IEA GeneID:135 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IEA GeneID:135 -> Molecular function: GO:0051393 [alpha-actinin binding] evidence: IEA GeneID:135 -> Biological process: GO:0001963 [synaptic transmission, dopaminergic] evidence: IEA GeneID:135 -> Biological process: GO:0001975 [response to amphetamine] evidence: IEA GeneID:135 -> Biological process: GO:0006171 [cAMP biosynthetic process] evidence: TAS GeneID:135 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA GeneID:135 -> Biological process: GO:0006469 [negative regulation of protein kinase activity] evidence: IEA GeneID:135 -> Biological process: GO:0006909 [phagocytosis] evidence: TAS GeneID:135 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:135 -> Biological process: GO:0006954 [inflammatory response] evidence: TAS GeneID:135 -> Biological process: GO:0006968 [cellular defense response] evidence: TAS GeneID:135 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: TAS GeneID:135 -> Biological process: GO:0007188 [adenylate cyclase-modulating G-protein coupled receptor signaling pathway] evidence: TAS GeneID:135 -> Biological process: GO:0007189 [adenylate cyclase-activating G-protein coupled receptor signaling pathway] evidence: IEA GeneID:135 -> Biological process: GO:0007190 [activation of adenylate cyclase activity] evidence: TAS GeneID:135 -> Biological process: GO:0007205 [protein kinase C-activating G-protein coupled receptor signaling pathway] evidence: IEA GeneID:135 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS GeneID:135 -> Biological process: GO:0007271 [synaptic transmission, cholinergic] evidence: IEA GeneID:135 -> Biological process: GO:0007417 [central nervous system development] evidence: TAS GeneID:135 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS GeneID:135 -> Biological process: GO:0007600 [sensory perception] evidence: TAS GeneID:135 -> Biological process: GO:0007626 [locomotory behavior] evidence: IEA GeneID:135 -> Biological process: GO:0008015 [blood circulation] evidence: TAS GeneID:135 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA GeneID:135 -> Biological process: GO:0014049 [positive regulation of glutamate secretion] evidence: IEA GeneID:135 -> Biological process: GO:0014057 [positive regulation of acetylcholine secretion, neurotransmission] evidence: IEA GeneID:135 -> Biological process: GO:0014061 [regulation of norepinephrine secretion] evidence: IEA GeneID:135 -> Biological process: GO:0031000 [response to caffeine] evidence: IEA GeneID:135 -> Biological process: GO:0032230 [positive regulation of synaptic transmission, GABAergic] evidence: IEA GeneID:135 -> Biological process: GO:0035249 [synaptic transmission, glutamatergic] evidence: IEA GeneID:135 -> Biological process: GO:0035810 [positive regulation of urine volume] evidence: IEA GeneID:135 -> Biological process: GO:0035815 [positive regulation of renal sodium excretion] evidence: IEA GeneID:135 -> Biological process: GO:0040013 [negative regulation of locomotion] evidence: IEA GeneID:135 -> Biological process: GO:0042311 [vasodilation] evidence: IEA GeneID:135 -> Biological process: GO:0042493 [response to drug] evidence: IEA GeneID:135 -> Biological process: GO:0042755 [eating behavior] evidence: IEA GeneID:135 -> Biological process: GO:0043116 [negative regulation of vascular permeability] evidence: IEA GeneID:135 -> Biological process: GO:0043154 [negative regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IEA GeneID:135 -> Biological process: GO:0043524 [negative regulation of neuron apoptotic process] evidence: IEA GeneID:135 -> Biological process: GO:0046636 [negative regulation of alpha-beta T cell activation] evidence: IEA GeneID:135 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:135 -> Biological process: GO:0048143 [astrocyte activation] evidence: IEA GeneID:135 -> Biological process: GO:0048167 [regulation of synaptic plasticity] evidence: IEA GeneID:135 -> Biological process: GO:0048812 [neuron projection morphogenesis] evidence: IEA GeneID:135 -> Biological process: GO:0050714 [positive regulation of protein secretion] evidence: IEA GeneID:135 -> Biological process: GO:0050728 [negative regulation of inflammatory response] evidence: IEA GeneID:135 -> Biological process: GO:0051881 [regulation of mitochondrial membrane potential] evidence: IEA GeneID:135 -> Biological process: GO:0051924 [regulation of calcium ion transport] evidence: IEA GeneID:135 -> Biological process: GO:0051968 [positive regulation of synaptic transmission, glutamatergic] evidence: IEA GeneID:135 -> Biological process: GO:0060079 [regulation of excitatory postsynaptic membrane potential] evidence: IEA GeneID:135 -> Biological process: GO:0060080 [regulation of inhibitory postsynaptic membrane potential] evidence: IEA GeneID:135 -> Biological process: GO:0060134 [prepulse inhibition] evidence: IEA GeneID:135 -> Biological process: GO:2001235 [positive regulation of apoptotic signaling pathway] evidence: IEA GeneID:135 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA GeneID:135 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS GeneID:135 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS GeneID:135 -> Cellular component: GO:0012505 [endomembrane system] evidence: IEA GeneID:135 -> Cellular component: GO:0014069 [postsynaptic density] evidence: IEA GeneID:135 -> Cellular component: GO:0016020 [membrane] evidence: TAS GeneID:135 -> Cellular component: GO:0030425 [dendrite] evidence: IEA GeneID:135 -> Cellular component: GO:0030673 [axolemma] evidence: IEA GeneID:135 -> Cellular component: GO:0032279 [asymmetric synapse] evidence: IEA GeneID:135 -> Cellular component: GO:0042734 [presynaptic membrane] evidence: IEA GeneID:135 -> Cellular component: GO:0043025 [neuronal cell body] evidence: IEA GeneID:135 -> Cellular component: GO:0044446 [intracellular organelle part] evidence: IDA GeneID:135 -> Cellular component: GO:0045211 [postsynaptic membrane] evidence: IEA GeneID:135 -> Cellular component: GO:0048786 [presynaptic active zone] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.