2024-03-29 10:42:20, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001276312 1915 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), transcript variant 1, mRNA. ACCESSION NM_001276312 VERSION NM_001276312.1 GI:443928955 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1915) AUTHORS McKimpson,W.M., Weinberger,J., Czerski,L., Zheng,M., Crow,M.T., Pessin,J.E., Chua,S.C. Jr. and Kitsis,R.N. TITLE The apoptosis inhibitor ARC alleviates the ER stress response to promote beta-cell survival JOURNAL Diabetes 62 (1), 183-193 (2013) PUBMED 22933109 REMARK GeneRIF: ARC is a previously unrecognized inhibitor of apoptosis in beta-cells and that its protective effects are mediated through suppression of the ER stress response pathway. REFERENCE 2 (bases 1 to 1915) AUTHORS Russell,J.F., Steckley,J.L., Coppola,G., Hahn,A.F., Howard,M.A., Kornberg,Z., Huang,A., Mirsattari,S.M., Merriman,B., Klein,E., Choi,M., Lee,H.Y., Kirk,A., Nelson-Williams,C., Gibson,G., Baraban,S.C., Lifton,R.P., Geschwind,D.H., Fu,Y.H. and Ptacek,L.J. TITLE Familial cortical myoclonus with a mutation in NOL3 JOURNAL Ann. Neurol. 72 (2), 175-183 (2012) PUBMED 22926851 REMARK GeneRIF: This study utilized unbiased, genome-wide approaches to identify a NOL3 mutation that likely causes Familial cortical myoclonus. REFERENCE 3 (bases 1 to 1915) AUTHORS Ao,J.E., Kuang,L.H., Zhou,Y., Zhao,R. and Yang,C.M. TITLE Hypoxia-inducible factor 1 regulated ARC expression mediated hypoxia induced inactivation of the intrinsic death pathway in p53 deficient human colon cancer cells JOURNAL Biochem. Biophys. Res. Commun. 420 (4), 913-917 (2012) PUBMED 22475487 REMARK GeneRIF: HIF-1alpha directly bound to hypoxia-responsive element located at -419 to -414 of ARC gene, which is essential for HIF-1-induced expression. REFERENCE 4 (bases 1 to 1915) AUTHORS Zaiman,A.L., Damico,R., Thoms-Chesley,A., Files,D.C., Kesari,P., Johnston,L., Swaim,M., Mozammel,S., Myers,A.C., Halushka,M., El-Haddad,H., Shimoda,L.A., Peng,C.F., Hassoun,P.M., Champion,H.C., Kitsis,R.N. and Crow,M.T. TITLE A critical role for the protein apoptosis repressor with caspase recruitment domain in hypoxia-induced pulmonary hypertension JOURNAL Circulation 124 (23), 2533-2542 (2011) PUBMED 22082675 REMARK GeneRIF: ARC, previously unlinked to pulmonary hypertension, is a critical determinant of vascular remodeling in this syndrome. REFERENCE 5 (bases 1 to 1915) AUTHORS Jo,D.G., Jun,J.I., Chang,J.W., Hong,Y.M., Song,S., Cho,D.H., Shim,S.M., Lee,H.J., Cho,C., Kim,D.H. and Jung,Y.K. TITLE Calcium binding of ARC mediates regulation of caspase 8 and cell death JOURNAL Mol. Cell. Biol. 24 (22), 9763-9770 (2004) PUBMED 15509781 REMARK GeneRIF: calcium binding mediates regulation of caspase 8 and cell death by ARC REFERENCE 6 (bases 1 to 1915) AUTHORS Nam,Y.J., Mani,K., Ashton,A.W., Peng,C.F., Krishnamurthy,B., Hayakawa,Y., Lee,P., Korsmeyer,S.J. and Kitsis,R.N. TITLE Inhibition of both the extrinsic and intrinsic death pathways through nonhomotypic death-fold interactions JOURNAL Mol. Cell 15 (6), 901-912 (2004) PUBMED 15383280 REMARK GeneRIF: ARC is recruited to the Fas DISC. By interacting with Fas and FADD through CARD-DD and CARD-DED interactions, ARC prevents DISC assembly and procaspase-8 activation. GeneRIF: The CARD of ARC binds the Bax C-terminus, preventing Bax activation and activation of the intrinsic mitochondrial pathway GeneRIF: ARC holds multiple death pathways in check by non-homotypic death-fold interactions. Loss of ARC disinhibits these, leading to accelerated DISC assembly and Bax activation and may be an apoptotic trigger in heart failure and ischemia-reperfusion. REFERENCE 7 (bases 1 to 1915) AUTHORS Ekhterae,D., Platoshyn,O., Zhang,S., Remillard,C.V. and Yuan,J.X. TITLE Apoptosis repressor with caspase domain inhibits cardiomyocyte apoptosis by reducing K+ currents JOURNAL Am. J. Physiol., Cell Physiol. 284 (6), C1405-C1410 (2003) PUBMED 12734105 REMARK GeneRIF: These results suggest that the antiapoptotic effect of apoptotic repressor with caspase recruitment domain is, in part, due to inhibition of voltage-gated potassium channels in cardiomyocytes. REFERENCE 8 (bases 1 to 1915) AUTHORS Li,P.F., Li,J., Muller,E.C., Otto,A., Dietz,R. and von Harsdorf,R. TITLE Phosphorylation by protein kinase CK2: a signaling switch for the caspase-inhibiting protein ARC JOURNAL Mol. Cell 10 (2), 247-258 (2002) PUBMED 12191471 REFERENCE 9 (bases 1 to 1915) AUTHORS Stoss,O., Schwaiger,F.W., Cooper,T.A. and Stamm,S. TITLE Alternative splicing determines the intracellular localization of the novel nuclear protein Nop30 and its interaction with the splicing factor SRp30c JOURNAL J. Biol. Chem. 274 (16), 10951-10962 (1999) PUBMED 10196175 REFERENCE 10 (bases 1 to 1915) AUTHORS Koseki,T., Inohara,N., Chen,S. and Nunez,G. TITLE ARC, an inhibitor of apoptosis expressed in skeletal muscle and heart that interacts selectively with caspases JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (9), 5156-5160 (1998) PUBMED 9560245 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CB959673.1, AK294145.1, AC074143.5 and AF064599.1. This sequence is a reference standard in the RefSeqGene project. Summary: This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform. Variants 1, 2, 4, and 5 encode the same protein (isoform MYP). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK294145.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025088 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## CDS uses downstream in-frame AUG :: upstream AUG and CDS extension is not conserved ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-38 CB959673.1 28-65 39-1423 AK294145.1 4-1388 1424-1424 AC074143.5 143910-143910 1425-1635 AK294145.1 1390-1600 1636-1915 AF064599.1 1102-1381 FEATURES Location/Qualifiers source 1..1915 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="16" /map="16q22.1" gene 1..1915 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /note="nucleolar protein 3 (apoptosis repressor with CARD domain)" /db_xref="GeneID:8996" /db_xref="HGNC:7869" /db_xref="MIM:605235" exon 1..78 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /inference="alignment:Splign:1.39.8" exon 79..384 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /inference="alignment:Splign:1.39.8" variation 346 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:146699716" variation 376 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:62057951" exon 385..569 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /inference="alignment:Splign:1.39.8" misc_feature 389..391 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /note="upstream in-frame stop codon" variation 481 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:113475662" variation 553 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:2233455" exon 570..872 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /inference="alignment:Splign:1.39.8" CDS 578..1204 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /note="isoform MYP is encoded by transcript variant 1; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein" /codon_start=1 /product="nucleolar protein 3 isoform MYP" /protein_id="NP_001263241.1" /db_xref="GI:443928956" /db_xref="CCDS:CCDS42176.1" /db_xref="GeneID:8996" /db_xref="HGNC:7869" /db_xref="MIM:605235" /translation="
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
" misc_feature 590..853 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /note="Caspase recruitment domain; Region: CARD; smart00114" /db_xref="CDD:128424" variation 601 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:369557885" variation 614 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="g" /db_xref="dbSNP:2233457" variation 652 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:199980306" variation 686 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:202111825" variation 743 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="g" /db_xref="dbSNP:375270565" variation 762 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:201067296" variation 797 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:375650340" variation 821 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:369265508" variation 827 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:201367451" exon 873..1196 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /inference="alignment:Splign:1.39.8" variation 908 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:2233458" variation 919 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="g" /db_xref="dbSNP:200144674" variation 937 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:371108668" variation 948 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="g" /replace="t" /db_xref="dbSNP:375028825" variation 985 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="g" /db_xref="dbSNP:2233459" variation 1083 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:377659624" variation 1104 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:375346192" variation 1130 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:367640749" variation 1152 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:371908750" variation 1155 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:201221648" variation 1163 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:201587168" STS 1168..1287 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /standard_name="RH47869" /db_xref="UniSTS:40524" variation 1174 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:368688530" variation 1192 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:188696118" exon 1197..1887 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /inference="alignment:Splign:1.39.8" variation 1215 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:377629448" variation 1233 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:199600705" variation 1240 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="g" /db_xref="dbSNP:201000974" STS 1254..1330 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /standard_name="RH41857" /db_xref="UniSTS:52321" variation 1254 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:2233460" variation 1331 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="" /replace="g" /db_xref="dbSNP:34549032" variation 1433 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:369479649" variation 1468 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="c" /db_xref="dbSNP:75280012" variation 1502 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:8057598" variation 1596 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:374851015" variation 1657 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:11548450" variation 1700 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:369065916" variation 1751..1753 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="" /replace="att" /db_xref="dbSNP:375713230" variation 1752..1753 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="" /replace="tt" /db_xref="dbSNP:368811483" variation 1753 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:111417515" variation 1835 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="a" /replace="g" /db_xref="dbSNP:372985188" variation 1857 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" /replace="c" /replace="t" /db_xref="dbSNP:149556040" polyA_site 1888 /gene="NOL3" /gene_synonym="ARC; FCM; MYP; NOP; NOP30" ORIGIN
gccgcagctgctgcacccacccccaccctgcccggccctttctgcaccgtcatctcctgccccgccgaggcttgacccgtgctgtccccctctcccttcctttgcccaccgattggagggacactctggaaaactcagttgaagaaagcggagagtctgcgtgtacacagtgcaatgatgtcagttaatgcactagtgagggcatgtgttgttcacggtacacagaagaaggaaccaccagcccttgggacacttaggcattggtgtagacaagggaacatttgagtcctggacgatggataggtccacggagcggagggaggagaaaaggattccagtcttagcgatcagcatcagcaaaggctccgaggtgccagaggcataagagtagatgccagtcctgggaaaggcaggggaggagaggagagccacggctgacgcttggggacagaaggaggagcctgaggaggagacaggacagagcgtctggagaggcaggaggacaccgagttccccgtgttggcctccaggtcctgtgcttgcggagccgtccggcggctgggatcgagccccgacaatgggcaacgcgcaggagcggccgtcagagactatcgaccgcgagcggaaacgcctggtcgagacgctgcaggcggactcgggactgctgttggacgcgctgctggcgcggggcgtgctcaccgggccagagtacgaggcattggatgcactgcctgatgccgagcgcagggtgcgccgcctactgctgctggtgcagggcaagggcgaggccgcctgccaggagctgctacgctgtgcccagcgtaccgcgggcgcgccggaccccgcttgggactggcagcacgtgggtccgggctaccgggaccgcagctatgaccctccatgcccaggccactggacgccggaggcacccggctcggggaccacatgccccgggttgcccagagcttcagaccctgacgaggccgggggccctgagggctccgaggcggtgcaatccgggaccccggaggagccagagccagagctggaagctgaggcctctaaagaggctgaaccggagccggagccagagccagagctggaacccgaggctgaagcagaaccagagccggaactggagccagaaccggacccagagcccgagcccgacttcgaggaaagggacgagtccgaagattcctgaaggccagagctctgacaggcggtgccccgcccatgctggataggacctgggatgctgctggagctgaatcggatgccaccaaggctcggtccagcccagtaccgctggaagtgaataaactccggagggtcggacgggacctgggctctctccacgattctggctgtttgcccaggaacttagggtgggtacctctgagtcccagggacctgggcaggcccaagcccaccacgagcatcatccagtcctcagccctaatctgcccttaggagtccaggctgcaccctggagatcccaaacctagccccctagtgggacaaggacctgaccctcctgcccgcatacacaacccatttcccctggtgagccacttggcagcatatgtaggtaccagctcaaccccacgcaagttcctgagctgaacatggagcaaggggagggtgacttctctccacatagggagggcttagagctcacagccttgggaagtgagactagaagaggggagcagaaagggaccttgagtagacaaaggccacacacatcattgtcattactgttttaattgtctggcttctctctggactgggagctcagtgaggattctgaccagtgacttacacaaaaggcgctctatacatattataatatattcgcttactaaatgaataaggactttccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8996 -> Molecular function: GO:0003723 [RNA binding] evidence: TAS GeneID:8996 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:8996 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI GeneID:8996 -> Biological process: GO:0006397 [mRNA processing] evidence: IEA GeneID:8996 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:8996 -> Biological process: GO:0008380 [RNA splicing] evidence: IEA GeneID:8996 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS GeneID:8996 -> Cellular component: GO:0005730 [nucleolus] evidence: IEA GeneID:8996 -> Cellular component: GO:0005739 [mitochondrion] evidence: ISS GeneID:8996 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:8996 -> Cellular component: GO:0016528 [sarcoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.