2024-04-25 15:17:15, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001271851 2644 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens Ras-related GTP binding C (RRAGC), transcript variant 2, mRNA. ACCESSION NM_001271851 VERSION NM_001271851.1 GI:427918101 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2644) AUTHORS Sancak,Y., Peterson,T.R., Shaul,Y.D., Lindquist,R.A., Thoreen,C.C., Bar-Peled,L. and Sabatini,D.M. TITLE The Rag GTPases bind raptor and mediate amino acid signaling to mTORC1 JOURNAL Science 320 (5882), 1496-1501 (2008) PUBMED 18497260 REFERENCE 2 (bases 1 to 2644) AUTHORS Suhr,M.L., Dysvik,B., Bruland,O., Warnakulasuriya,S., Amaratunga,A.N., Jonassen,I., Vasstrand,E.N. and Ibrahim,S.O. TITLE Gene expression profile of oral squamous cell carcinomas from Sri Lankan betel quid users JOURNAL Oncol. Rep. 18 (5), 1061-1075 (2007) PUBMED 17914555 REFERENCE 3 (bases 1 to 2644) AUTHORS Wang,A.G., Yoon,S.Y., Oh,J.H., Jeon,Y.J., Kim,M., Kim,J.M., Byun,S.S., Yang,J.O., Kim,J.H., Kim,D.G., Yeom,Y.I., Yoo,H.S., Kim,Y.S. and Kim,N.S. TITLE Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags JOURNAL Biochem. Biophys. Res. Commun. 345 (3), 1022-1032 (2006) PUBMED 16712791 REFERENCE 4 (bases 1 to 2644) AUTHORS Sekiguchi,T., Todaka,Y., Wang,Y., Hirose,E., Nakashima,N. and Nishimoto,T. TITLE A novel human nucleolar protein, Nop132, binds to the G proteins, RRAG A/C/D JOURNAL J. Biol. Chem. 279 (9), 8343-8350 (2004) PUBMED 14660641 REFERENCE 5 (bases 1 to 2644) AUTHORS Sekiguchi,T., Hirose,E., Nakashima,N., Ii,M. and Nishimoto,T. TITLE Novel G proteins, Rag C and Rag D, interact with GTP-binding proteins, Rag A and Rag B JOURNAL J. Biol. Chem. 276 (10), 7246-7257 (2001) PUBMED 11073942 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL139260.19, BG717489.1, BI461665.1, ES308561.1, AK298788.1, BC016668.1, AW327252.1, AK298573.1, CX761032.1, CB132041.1, HY264464.1, HY202961.1 and BQ003663.1. Summary: This gene encodes a member of the GTR/RAG GTP-binding protein family. The encoded protein is a monomeric guanine nucleotide-binding protein which forms a heterodimer with RRAGA and RRAGB and is primarily localized to the cytoplasm. The encoded protein promotes intracellular localization of the mTOR complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]. Transcript Variant: This variant (2) uses an alternate in-frame splice site in the coding region, compared to variant 1. It encodes isoform 2 which is shorter than isoform 1. ##Evidence-Data-START## Transcript exon combination :: AK298788.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-4 AL139260.19 75921-75924 c 5-48 BG717489.1 11-54 49-51 AL139260.19 75874-75876 c 52-93 BI461665.1 5-46 94-104 ES308561.1 1-11 105-259 AK298788.1 1-155 260-414 BC016668.1 105-259 415-562 AK298788.1 311-458 563-1495 BC016668.1 510-1442 1496-1497 AW327252.1 303-304 1498-1564 AK298573.1 1123-1189 1565-1721 CX761032.1 578-734 1722-2173 CB132041.1 147-598 2174-2235 HY264464.1 2-63 c 2236-2626 HY202961.1 1-391 c 2627-2644 BQ003663.1 1-18 c FEATURES Location/Qualifiers source 1..2644 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p34" gene 1..2644 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="Ras-related GTP binding C" /db_xref="GeneID:64121" /db_xref="HGNC:19902" /db_xref="MIM:608267" exon 1..414 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /inference="alignment:Splign:1.39.8" misc_feature 25..27 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="upstream in-frame stop codon" CDS 178..1275 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="isoform 2 is encoded by transcript variant 2; Rag C protein; ras-related GTP-binding protein C; GTPase-interacting protein 2" /codon_start=1 /product="ras-related GTP-binding protein C isoform 2" /protein_id="NP_001258780.1" /db_xref="GI:427918102" /db_xref="GeneID:64121" /db_xref="HGNC:19902" /db_xref="MIM:608267" /translation="
MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLRRSGKSSIQKIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI
" misc_feature 364..942 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="Gtr1/RagA G protein conserved region; Region: Gtr1_RagA; pfam04670" /db_xref="CDD:147030" misc_feature 364..786 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="Rag GTPase, subfamily of Ras-related GTPases, includes Ras-related GTP-binding proteins C and D; Region: RagC_like; cd11385" /db_xref="CDD:206745" misc_feature 379..402 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="G1 box; other site" /db_xref="CDD:206745" misc_feature order(394..405,430..432,607..612,616..618,730..738) /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206745" misc_feature 421..432 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="G3 box; other site" /db_xref="CDD:206745" misc_feature order(427..432,487..492) /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="Switch II region; other site" /db_xref="CDD:206745" misc_feature 607..618 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="G4 box; other site" /db_xref="CDD:206745" misc_feature 730..738 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /note="G5 box; other site" /db_xref="CDD:206745" exon 415..516 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /inference="alignment:Splign:1.39.8" exon 517..716 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /inference="alignment:Splign:1.39.8" exon 717..831 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /inference="alignment:Splign:1.39.8" exon 832..974 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /inference="alignment:Splign:1.39.8" exon 975..1123 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /inference="alignment:Splign:1.39.8" exon 1124..2631 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /inference="alignment:Splign:1.39.8" STS 1160..1407 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /standard_name="RH50026" /db_xref="UniSTS:36282" STS 1169..1442 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /standard_name="SHGC-74629" /db_xref="UniSTS:8735" STS 1294..1424 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /standard_name="G29137" /db_xref="UniSTS:81671" variation 1479 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /replace="a" /replace="c" /db_xref="dbSNP:201546414" STS 1497..1631 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /standard_name="SHGC-74630" /db_xref="UniSTS:20965" STS 1613..1866 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /standard_name="SGC38299" /db_xref="UniSTS:71855" STS 1743..1823 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /standard_name="D1S261E" /db_xref="UniSTS:147342" variation 1772 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" /replace="c" /replace="t" /db_xref="dbSNP:9694" polyA_signal 2609..2614 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" polyA_site 2631 /gene="RRAGC" /gene_synonym="GTR2; RAGC; TIB929" ORIGIN
ggctgggcttcggctcggggcctatgagagccgggctccggggggcgggccggactgtggcggctgccgggggcggtggcggtggtggcggcggcggcggaggcggactggggaggcggcggcctggctcggcctggcctggcctgtcagggcgcgggcggcggcggctccagcaccatgtccctgcagtacggggcggaggagacgcccctcgccggcagttacggcgcggccgattcgtttccaaaggacttcggctacggcgtggaggaggaggaagaggaggcggcggcggcgggcggaggggttggggcaggggcaggcggtggctgtggtccggggggcgctgacagctccaagccgaggattctgctcatgggactccggcgcagcggcaagtcctccatccagaagatatgggattttcctgggcaaatggacttttttgacccaacctttgactatgagatgatcttcaggggaacaggagcattgatatacgtcattgacgcacaggatgactacatggaggctttaacaagacttcacattactgtttctaaagcctacaaagttaacccagacatgaattttgaggtttttattcacaaagttgatggtctgtctgatgatcacaaaatagaaacacagagggacattcatcaaagggccaatgatgaccttgcagatgctgggctagaaaaactccatcttagcttttatctgactagtatctatgaccattcaatatttgaagcctttagtaaggtggtgcagaaactcattccacaactgccgaccttggaaaacctattaaatatctttatatcaaattcaggtattgaaaaagcttttctctttgatgttgtcagcaaaatctacattgcaacagacagttcccctgtggatatgcaatcttatgaactttgctgtgacatgatcgatgttgtaattgatgtgtcttgtatatatgggttaaaggaagatggaagtggaagtgcttatgacaaagaatctatggcaattatcaagctgaataatacaactgtcctttatttaaaggaggtgactaaatttttggcactggtctgcattctaagggaagaaagctttgaaagaaaaggtttaatagactacaacttccactgtttccgaaaagctattcatgaggtttttgaggtgggtgtgacttctcacaggagctgtggtcaccagactagtgcctccagtctgaaagcgctgacacacaatggcacgccacgaaacgccatctagtctgaatcccagcgtcggggctctgtgccagcttactcttcactccagggtcggatgccacgtgctacaggacatgggagctgctgcttgtgggaatctggtgcctgttccactagagacaaggggtagagtttctcatttggatgaaaaccccttcaactggtggtgtacaactgaagctactatatcttttttgaaaatggcaaaaaaaaaaaaaaaaaattctggagaccacagaactcaagtgtgtgtttctcctcttttgggtcccctttaagtagttgggatattttggacctggagataacaccagttacccatccttaccagggaatgttgccatcaattccagttgaaaataatagaaaagactgaatttttatatgcttcacttaggctttcatttgagtagactctaaaaattctgccttgcttaagttctaacactgcctctcagatttcagttttggacattgcacaactaagaccttttaaatgcatttgcttgctaactcggaagacacatagtctgcagcaagacattcctatattgaagaaatgagagaaaattttatgctgcatcaggtggagagcaaggctcaacggtggttgcattagttccctcggaagtattgaaaaaactttgaaatggaagaaaatttttgcacctatgttctgagtaccagatgtctgggttctttcttctgcattagataaatgatcatgctcagtgtaacaaagggaattaaaagttttcccacagtccccttctaggggagaaactcattgtgtcactgaaatgtttagcttactttaatcttgatatcagcctctacagaccttttattctaagctatcgagcttcttgattgcatttggttgaccacgagtgaccctaaggcattgggggactgtccactgggagttggagtgagcacgtggtgctgcaacaggcattgttttacatactttgtctctagtattctgacaccaagtgtcaactgtggtactttctttgcctaggatatgaattcataattgttgcttttgttgatggttgataccctttccattgatttaaacctaacacattatttctattccacatgcccagtagacatatattccaaagccactggaccacttgagtacataagtgccactgtttaatgcaatatgtatattcaggtctgtaaagctaacagtgtgacttggagtgcttcctgcaggtgattctgacttgagtatttacatggaccatggtgatatccaaaagaaaaatgctttttatatttatagattatttcattgaactatatatgaaatgggtatcaataaatgtatttactccaaaataaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:64121 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: NAS GeneID:64121 -> Molecular function: GO:0003924 [GTPase activity] evidence: IDA GeneID:64121 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:64121 -> Molecular function: GO:0005525 [GTP binding] evidence: IDA GeneID:64121 -> Molecular function: GO:0019003 [GDP binding] evidence: IDA GeneID:64121 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI GeneID:64121 -> Biological process: GO:0006184 [GTP catabolic process] evidence: IDA GeneID:64121 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: NAS GeneID:64121 -> Biological process: GO:0006915 [apoptotic process] evidence: NAS GeneID:64121 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS GeneID:64121 -> Biological process: GO:0008380 [RNA splicing] evidence: NAS GeneID:64121 -> Biological process: GO:0016049 [cell growth] evidence: NAS GeneID:64121 -> Biological process: GO:0034613 [cellular protein localization] evidence: ISS GeneID:64121 -> Biological process: GO:0071230 [cellular response to amino acid stimulus] evidence: ISS GeneID:64121 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:64121 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:64121 -> Cellular component: GO:0005764 [lysosome] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.