GGRNA Home | Help | Advanced search

2024-04-27 02:02:15, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001260496            1549 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens radixin (RDX), transcript variant 6, mRNA.
ACCESSION   NM_001260496
VERSION     NM_001260496.1  GI:386781608
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1549)
  AUTHORS   Titushkin,I., Sun,S., Paul,A. and Cho,M.
  TITLE     Control of adipogenesis by ezrin, radixin and moesin-dependent
            biomechanics remodeling
  JOURNAL   J Biomech 46 (3), 521-526 (2013)
   PUBMED   23116763
  REMARK    GeneRIF: Control of adipogenesis by ezrin, radixin and
            moesin-dependent biomechanics remodeling.
REFERENCE   2  (bases 1 to 1549)
  AUTHORS   Zhang,L., Xiao,R., Xiong,J., Leng,J., Ehtisham,A., Hu,Y., Ding,Q.,
            Xu,H., Liu,S., Wang,J., Tang,D.G. and Zhang,Q.
  TITLE     Activated ERM protein plays a critical role in drug resistance of
            MOLT4 cells induced by CCL25
  JOURNAL   PLoS ONE 8 (1), E52384 (2013)
   PUBMED   23326330
  REMARK    GeneRIF: Data suggest that P-glycoprotein associate with the
            F-actin cytoskeleton through ezrin/radixin/moesin (ERM) in
            CCR9/CCL25 induced multidrug resistance of acute T-lymphocytic
            leukemia (T-ALL) cells.
REFERENCE   3  (bases 1 to 1549)
  AUTHORS   Darmellah,A., Rayah,A., Auger,R., Cuif,M.H., Prigent,M., Arpin,M.,
            Alcover,A., Delarasse,C. and Kanellopoulos,J.M.
  TITLE     Ezrin/radixin/moesin are required for the purinergic P2X7 receptor
            (P2X7R)-dependent processing of the amyloid precursor protein
  JOURNAL   J. Biol. Chem. 287 (41), 34583-34595 (2012)
   PUBMED   22891241
  REMARK    GeneRIF: Ezrin/radixin/moesin are required for the purinergic P2X7
            receptor (P2X7R)-dependent processing of the amyloid precursor
            protein.
REFERENCE   4  (bases 1 to 1549)
  AUTHORS   Perez-Cornejo,P., Gokhale,A., Duran,C., Cui,Y., Xiao,Q.,
            Hartzell,H.C. and Faundez,V.
  TITLE     Anoctamin 1 (Tmem16A) Ca2+-activated chloride channel
            stoichiometrically interacts with an ezrin-radixin-moesin network
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (26), 10376-10381 (2012)
   PUBMED   22685202
  REMARK    GeneRIF: Ano1, ezrin, and moesin/radixin colocalize apically in
            salivary gland epithelial cells, and overexpression of moesin and
            Ano1 in HEK cells alters the subcellular localization of both
            proteins
REFERENCE   5  (bases 1 to 1549)
  AUTHORS   Chen,S.D., Song,M.M., Zhong,Z.Q., Li,N., Wang,P.L., Cheng,S.,
            Bai,R.X. and Yuan,H.S.
  TITLE     Knockdown of radixin by RNA interference suppresses the growth of
            human pancreatic cancer cells in vitro and in vivo
  JOURNAL   Asian Pac. J. Cancer Prev. 13 (3), 753-759 (2012)
   PUBMED   22631643
  REMARK    GeneRIF: results suggest that radixin might play a critical role in
            pancreatic cancer progression, possibly through involvement of
            down-regulation of TSP-1 and E-cadherin expression.
REFERENCE   6  (bases 1 to 1549)
  AUTHORS   Takahashi,K., Sasaki,T., Mammoto,A., Takaishi,K., Kameyama,T.,
            Tsukita,S. and Takai,Y.
  TITLE     Direct interaction of the Rho GDP dissociation inhibitor with
            ezrin/radixin/moesin initiates the activation of the Rho small G
            protein
  JOURNAL   J. Biol. Chem. 272 (37), 23371-23375 (1997)
   PUBMED   9287351
REFERENCE   7  (bases 1 to 1549)
  AUTHORS   Stemmer-Rachamimov,A.O., Gonzalez-Agosti,C., Xu,L., Burwick,J.A.,
            Beauchamp,R., Pinney,D., Louis,D.N. and Ramesh,V.
  TITLE     Expression of NF2-encoded merlin and related ERM family proteins in
            the human central nervous system
  JOURNAL   J. Neuropathol. Exp. Neurol. 56 (6), 735-742 (1997)
   PUBMED   9184664
REFERENCE   8  (bases 1 to 1549)
  AUTHORS   Hirao,M., Sato,N., Kondo,T., Yonemura,S., Monden,M., Sasaki,T.,
            Takai,Y., Tsukita,S. and Tsukita,S.
  TITLE     Regulation mechanism of ERM (ezrin/radixin/moesin) protein/plasma
            membrane association: possible involvement of phosphatidylinositol
            turnover and Rho-dependent signaling pathway
  JOURNAL   J. Cell Biol. 135 (1), 37-51 (1996)
   PUBMED   8858161
REFERENCE   9  (bases 1 to 1549)
  AUTHORS   Wilgenbus,K.K., Milatovich,A., Francke,U. and Furthmayr,H.
  TITLE     Molecular cloning, cDNA sequence, and chromosomal assignment of the
            human radixin gene and two dispersed pseudogenes
  JOURNAL   Genomics 16 (1), 199-206 (1993)
   PUBMED   8486357
REFERENCE   10 (bases 1 to 1549)
  AUTHORS   Sato,N., Funayama,N., Nagafuchi,A., Yonemura,S., Tsukita,S. and
            Tsukita,S.
  TITLE     A gene family consisting of ezrin, radixin and moesin. Its specific
            localization at actin filament/plasma membrane association sites
  JOURNAL   J. Cell. Sci. 103 (PT 1), 131-143 (1992)
   PUBMED   1429901
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DQ916739.1 and AP000901.5.
            
            Summary: Radixin is a cytoskeletal protein that may be important in
            linking actin to the plasma membrane. It is highly similar in
            sequence to both ezrin and moesin. The radixin gene has been
            localized by fluorescence in situ hybridization to 11q23. A
            truncated version representing a pseudogene (RDXP2) was assigned to
            Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was
            mapped to 11p by Southern and PCR analyses. Multiple alternatively
            spliced transcript variants encoding different isoforms have been
            found for this gene. [provided by RefSeq, May 2012].
            
            Transcript Variant: This variant (6) lacks multiple exons in the
            coding region, compared to variant 1. The resulting isoform (5)
            lacks two internal segments, compared to isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ916739.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025082, ERS025084 [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1364              DQ916739.1         1-1364
            1365-1549           AP000901.5         47335-47519         c
FEATURES             Location/Qualifiers
     source          1..1549
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11q23"
     gene            1..1549
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /note="radixin"
                     /db_xref="GeneID:5962"
                     /db_xref="HGNC:9944"
                     /db_xref="MIM:179410"
     exon            1..246
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /inference="alignment:Splign:1.39.8"
     exon            247..322
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    254..256
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /note="upstream in-frame stop codon"
     CDS             311..913
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /note="isoform 5 is encoded by transcript variant 6"
                     /codon_start=1
                     /product="radixin isoform 5"
                     /protein_id="NP_001247425.1"
                     /db_xref="GI:386781609"
                     /db_xref="CCDS:CCDS58173.1"
                     /db_xref="GeneID:5962"
                     /db_xref="HGNC:9944"
                     /db_xref="MIM:179410"
                     /translation="
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQMRSCQSSIKQM
"
     misc_feature    329..>703
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /note="Band 4.1 homologues; Region: B41; smart00295"
                     /db_xref="CDD:214604"
     misc_feature    335..472
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /note="FERM N-terminal domain; Region: FERM_N; pfam09379"
                     /db_xref="CDD:220215"
     misc_feature    491..>703
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /note="FERM central domain; Region: FERM_M; pfam00373"
                     /db_xref="CDD:215882"
     misc_feature    <620..847
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /note="Ezrin/radixin/moesin family; Region: ERM;
                     pfam00769"
                     /db_xref="CDD:216108"
     exon            323..406
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /inference="alignment:Splign:1.39.8"
     exon            407..681
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /inference="alignment:Splign:1.39.8"
     exon            682..714
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /inference="alignment:Splign:1.39.8"
     exon            715..884
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /inference="alignment:Splign:1.39.8"
     variation       1211
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2298500"
     variation       1301
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2298501"
     STS             1419..1504
                     /gene="RDX"
                     /gene_synonym="DFNB24"
                     /standard_name="RH91872"
                     /db_xref="UniSTS:83883"
     polyA_signal    1529..1534
                     /gene="RDX"
                     /gene_synonym="DFNB24"
     polyA_site      1549
                     /gene="RDX"
                     /gene_synonym="DFNB24"
ORIGIN      
ttggcgctcagtccgcggcgcgaggacggccggccggcagggggaggcgggggggcgccgggcagccccgccttttcccgcggaggcgccgagcggccatattgcggagctgtctgcggtggcggcggcgcctctcgtctcccgcggcccagcgctcgcaccaccgcttctccctccctgtcgcagccgcgccgccgcgcagcgccccagccacacgccggcgggcagaagccgcccgctctccggaaagtgataacagaattcattgaagtggagaatttttaaagaaggtaacaaaaagagaaagaaaatgccgaaaccaatcaacgtaagagtaactacaatggatgctgagctggaatttgccattcagcccaatacaactggcaaacaactttttgaccaggtaacacagcaggatgttaaaaaagagaatcctttacagttcaagtttagagctaaattctttcctgaagatgtttctgaggaattaattcaagaaataacccagagactcttcttcttgcaagttaaagaagccatcttaaatgatgagatatattgcccgccagaaactgcagttcttttggcttcctatgctgtccaagccaagtatggagattacaataaagagattcataagccaggctacctggctaatgatagactcctaccccagcgtgtattggaacaacacaaactaacaaaagaacaagatgaaaccaagaaaacacaaaatgatgttcttcatgctgagaatgttaaagcaggccgtgataagtacaagactctgcgacagattcgacaaggcaatacaaagcagcgtatcgatgagtttgaagcaatgtggggacccaaactgtatgcattgttccagatgcgctcttgccaaagcagcataaagcaaatgtaacccttaggaagaaggctccctccctcactaggcccctggctactgacttatgggaagctttaggataaggacatacctggtgttctgaatgtgtatatcccccaaagtctgcaatctcagctggaactggatggaccagtattccattacccagggccctggctcatggttctctcctcttctcagtttactgttggatttccctttcttgctattctctttctctccagacccctctcaattgcctttcctaaagacagaccttagcaagatgggccaggacttgggacttcgcacagcaccctgcagtcccaagccagcatctactgcaccccatcttcaggactctatcccccaaacatgctggaaggcatcagcttatgagaacccacttttttctgcatgactagcttgtaaggaagaatctatggacaggatttccaagaatttcccactttttcaaaaaatgtatgtgacttatatttggcttcaatccaagagcaaactcagtggtgaacagctccatttctgtgcacatgttggtggaatctgcagaaatcgatgcaacatttctttcctgtctgggctgtttgtataattgtatataaatgtagcaataaatatattctaacatca
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:5962 -> Molecular function: GO:0003779 [actin binding] evidence: IEA
            GeneID:5962 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:5962 -> Biological process: GO:0051693 [actin filament capping] evidence: IEA
            GeneID:5962 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
            GeneID:5962 -> Cellular component: GO:0005856 [cytoskeleton] evidence: IEA
            GeneID:5962 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
            GeneID:5962 -> Cellular component: GO:0005925 [focal adhesion] evidence: IDA
            GeneID:5962 -> Cellular component: GO:0019898 [extrinsic to membrane] evidence: IEA
            GeneID:5962 -> Cellular component: GO:0032154 [cleavage furrow] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.