Home |
Help |
Advanced search
2024-05-04 20:06:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001258351 954 bp mRNA linear PRI 20-APR-2013
DEFINITION Homo sapiens granzyme M (lymphocyte met-ase 1) (GZMM), transcript
variant 2, mRNA.
ACCESSION NM_001258351
VERSION NM_001258351.1 GI:385275109
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 954)
AUTHORS Wang,S., Xia,P., Shi,L. and Fan,Z.
TITLE FADD cleavage by NK cell granzyme M enhances its self-association
to facilitate procaspase-8 recruitment for auto-processing leading
to caspase cascade
JOURNAL Cell Death Differ. 19 (4), 605-615 (2012)
PUBMED 21979465
REMARK GeneRIF: FADD cleavage by NK cell granzyme M enhances its
self-association to facilitate procaspase-8 recruitment for
auto-processing leading to caspase cascade.
REFERENCE 2 (bases 1 to 954)
AUTHORS Bovenschen,N., de Koning,P.J., Quadir,R., Broekhuizen,R.,
Damen,J.M., Froelich,C.J., Slijper,M. and Kummer,J.A.
TITLE NK cell protease granzyme M targets alpha-tubulin and disorganizes
the microtubule network
JOURNAL J. Immunol. 180 (12), 8184-8191 (2008)
PUBMED 18523284
REMARK GeneRIF: Granzyme M targets major components of the cytoskeleton
that likely contribute to natural killer (NK) cell-induced cell
death.
REFERENCE 3 (bases 1 to 954)
AUTHORS Lu,H., Hou,Q., Zhao,T., Zhang,H., Zhang,Q., Wu,L. and Fan,Z.
TITLE Granzyme M directly cleaves inhibitor of caspase-activated DNase
(CAD) to unleash CAD leading to DNA fragmentation
JOURNAL J. Immunol. 177 (2), 1171-1178 (2006)
PUBMED 16818775
REMARK GeneRIF: Granzyme (Gzm)M can directly degrade inhibitor of
caspase-activated DNase (ICAD) to activate CAD, leading to DNA
damage; GzmM cleaves DNA damage sensor enzyme poly(ADP-ribose)
polymerase to prevent cellular DNA repair and force apoptosis.
REFERENCE 4 (bases 1 to 954)
AUTHORS Mahrus,S., Kisiel,W. and Craik,C.S.
TITLE Granzyme M is a regulatory protease that inactivates proteinase
inhibitor 9, an endogenous inhibitor of granzyme B
JOURNAL J. Biol. Chem. 279 (52), 54275-54282 (2004)
PUBMED 15494398
REMARK GeneRIF: proteinase inhibitor 9 was effectively hydrolyzed and
inactivated by human granzyme M, raising the possibility that this
orphan granzyme bypasses proteinase inhibitor 9 inhibition of
granzyme B
REFERENCE 5 (bases 1 to 954)
AUTHORS Kelly,J.M., Waterhouse,N.J., Cretney,E., Browne,K.A., Ellis,S.,
Trapani,J.A. and Smyth,M.J.
TITLE Granzyme M mediates a novel form of perforin-dependent cell death
JOURNAL J. Biol. Chem. 279 (21), 22236-22242 (2004)
PUBMED 15028722
REMARK GeneRIF: granzyme M represents a third major and specialized
perforin-dependent cell death pathway that plays a significant role
in death mediated by NK cells
REFERENCE 6 (bases 1 to 954)
AUTHORS Krenacs,L., Smyth,M.J., Bagdi,E., Krenacs,T., Kopper,L.,
Rudiger,T., Zettl,A., Muller-Hermelink,H.K., Jaffe,E.S. and
Raffeld,M.
TITLE The serine protease granzyme M is preferentially expressed in
NK-cell, gamma delta T-cell, and intestinal T-cell lymphomas:
evidence of origin from lymphocytes involved in innate immunity
JOURNAL Blood 101 (9), 3590-3593 (2003)
PUBMED 12506019
REMARK GeneRIF: GM expression is a distinctive feature of the nasal
NK/T-cell, gamma delta T-cell, and intestinal T-cell lymphomas, and
suggest that these tumors develop from lymphocytes involved in
innate immunity.
REFERENCE 7 (bases 1 to 954)
AUTHORS Smyth,M.J., O'Connor,M.D. and Trapani,J.A.
TITLE Granzymes: a variety of serine protease specificities encoded by
genetically distinct subfamilies
JOURNAL J. Leukoc. Biol. 60 (5), 555-562 (1996)
PUBMED 8929545
REMARK Review article
REFERENCE 8 (bases 1 to 954)
AUTHORS Pilat,D., Fink,T., Obermaier-Skrobanek,B., Zimmer,M., Wekerle,H.,
Lichter,P. and Jenne,D.E.
TITLE The human Met-ase gene (GZMM): structure, sequence, and close
physical linkage to the serine protease gene cluster on 19p13.3
JOURNAL Genomics 24 (3), 445-450 (1994)
PUBMED 7713495
REFERENCE 9 (bases 1 to 954)
AUTHORS Baker,E., Sutherland,G.R. and Smyth,M.J.
TITLE The gene encoding a human natural killer cell granule serine
protease, Met-ase 1, maps to chromosome 19p13.3
JOURNAL Immunogenetics 39 (4), 294-295 (1994)
PUBMED 8119738
REFERENCE 10 (bases 1 to 954)
AUTHORS Smyth,M.J., Sayers,T.J., Wiltrout,T., Powers,J.C. and Trapani,J.A.
TITLE Met-ase: cloning and distinct chromosomal location of a serine
protease preferentially expressed in human natural killer cells
JOURNAL J. Immunol. 151 (11), 6195-6205 (1993)
PUBMED 8245461
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CR991101.1, BC025701.1 and
CD366947.1.
Summary: Human natural killer (NK) cells and activated lymphocytes
express and store a distinct subset of neutral serine proteases
together with proteoglycans and other immune effector molecules in
large cytoplasmic granules. These serine proteases are collectively
termed granzymes and include 4 distinct gene products: granzyme A,
granzyme B, granzyme H, and the protein encoded by this gene,
granzyme M. Two transcript variants encoding different isoforms
have been found for this gene. [provided by RefSeq, Apr 2012].
Transcript Variant: This variant (2) uses an alternate splice
junction at the 5' end of a coding exon compared to variant 1, that
causes a frameshift. The resulting isoform (2) is shorter at the
N-terminus compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BI823094.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025089 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-457 CR991101.1 1-457
458-931 BC025701.1 434-907
932-954 CD366947.1 1-23 c
FEATURES Location/Qualifiers
source 1..954
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19p13.3"
gene 1..954
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/note="granzyme M (lymphocyte met-ase 1)"
/db_xref="GeneID:3004"
/db_xref="HGNC:4712"
/db_xref="MIM:600311"
exon 1..93
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/inference="alignment:Splign:1.39.8"
variation 4
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:16990734"
variation 7
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:371091671"
variation 35
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="c"
/db_xref="dbSNP:148492637"
variation 50
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:201728234"
variation 75
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:61729587"
exon 94..246
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/inference="alignment:Splign:1.39.8"
variation 97
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:201257717"
variation 115
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:139076851"
variation 122
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:373840917"
variation 123
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:143995851"
variation 137
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="g"
/db_xref="dbSNP:200360663"
variation 141
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:145060399"
variation 143
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:148691419"
variation 148
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:368042562"
CDS 152..808
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/note="isoform 2 is encoded by transcript variant 2;
lymphocyte met-ase 1; HU-Met-1; Met-1 serine protease;
natural killer cell granular protease"
/codon_start=1
/product="granzyme M isoform 2"
/protein_id="NP_001245280.1"
/db_xref="GI:385275110"
/db_xref="GeneID:3004"
/db_xref="HGNC:4712"
/db_xref="MIM:600311"
/translation="
MASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA
"
misc_feature 152..790
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/note="Trypsin-like serine protease; Many of these are
synthesized as inactive precursor zymogens that are
cleaved during limited proteolysis to generate their
active forms. Alignment contains also inactive enzymes
that have substitutions of the catalytic triad...; Region:
Tryp_SPc; cd00190"
/db_xref="CDD:29152"
misc_feature order(230..232,365..367,653..655)
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/note="active site"
/db_xref="CDD:29152"
misc_feature order(635..637,704..706,710..712)
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/note="substrate binding sites [chemical binding]; other
site"
/db_xref="CDD:29152"
variation 154
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:370173494"
variation 156
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:61729586"
variation 157
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:151192827"
variation 182
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:140327613"
variation 188
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="g"
/db_xref="dbSNP:146522321"
variation 222
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:374939287"
variation 239
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="g"
/replace="t"
/db_xref="dbSNP:147907546"
exon 247..382
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/inference="alignment:Splign:1.39.8"
variation 262
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:376460584"
variation 275
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372439590"
variation 295
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:370698507"
variation 317
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:114537924"
variation 324..325
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace=""
/replace="t"
/db_xref="dbSNP:34174518"
variation 335
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="c"
/db_xref="dbSNP:77680573"
variation 343
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:373532340"
variation 372
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="c"
/db_xref="dbSNP:148344737"
variation 373
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:142179152"
exon 383..646
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/inference="alignment:Splign:1.39.8"
variation 388
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:201550779"
variation 416
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:146201764"
variation 420
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:139221174"
variation 431
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="c"
/db_xref="dbSNP:142301648"
variation 435
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="g"
/replace="t"
/db_xref="dbSNP:199699879"
variation 439
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="g"
/replace="t"
/db_xref="dbSNP:201131588"
variation 440
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:140428817"
variation 464
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:150512032"
variation 478
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372337474"
variation 483
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="g"
/db_xref="dbSNP:375216906"
variation 487
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:373711246"
variation 502
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:150398893"
variation 503
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:199911384"
variation 506
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:202213878"
variation 515
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:369292401"
variation 516
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:58379043"
variation 524
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200669012"
variation 525
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:369942908"
variation 538
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:59235301"
variation 541
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:59771750"
variation 555
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201897461"
variation 594
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:373974834"
variation 610
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:377563439"
variation 619
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11672721"
variation 632
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200398398"
exon 647..937
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/inference="alignment:Splign:1.39.8"
variation 648
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="g"
/replace="t"
/db_xref="dbSNP:139484295"
variation 650
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201561127"
variation 671
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="t"
/db_xref="dbSNP:374806995"
variation 684
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:59539774"
variation 695
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1599882"
variation 696
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:17845771"
variation 700
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:371239880"
variation 705
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="c"
/db_xref="dbSNP:374422648"
STS 722..853
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/standard_name="RH71363"
/db_xref="UniSTS:71365"
variation 724
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:139629210"
variation 742
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:58562291"
variation 745
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="g"
/db_xref="dbSNP:58601458"
variation 746
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200659579"
variation 758
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:368863219"
variation 769
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:141658632"
variation 794
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:142892784"
variation 798
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:151036435"
variation 801
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="t"
/db_xref="dbSNP:371890199"
variation 802
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:376548111"
variation 807
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="c"
/replace="g"
/db_xref="dbSNP:370155439"
variation 816
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200816488"
variation 846
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="c"
/db_xref="dbSNP:111763479"
variation 892
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:116707574"
variation 906
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="g"
/db_xref="dbSNP:113273340"
polyA_signal 912..917
/gene="GZMM"
/gene_synonym="LMET1; MET1"
polyA_site 937
/gene="GZMM"
/gene_synonym="LMET1; MET1"
variation 937
/gene="GZMM"
/gene_synonym="LMET1; MET1"
/replace="a"
/replace="t"
/db_xref="dbSNP:79638775"
ORIGIN
ggccggggccagcacccacactgggtctccacagcggcatggaggcctgcgtgtcttcactgctggtgctggccctgggggccctgtcagtagctcctttgggacccagatcatcgggggccgggaggtgatcccccactcgcgcccgtacatggcctcactgcagagaaatggctcccacctgtgcgggggtgtcctggtgcacccaaagtgggtgctgacggctgcccactgcctggcccagcggatggcccagctgaggctggtgctggggctccacaccctggacagccccggtctcaccttccacatcaaggcagccatccagcaccctcgctacaagcccgtccctgccctggagaacgacctcgcgctgcttcagctggacgggaaagtgaagcccagccggaccatccggccgttggccctgcccagtaagcgccaggtggtggcagcagggactcggtgcagcatggccggctgggggctgacccaccagggcgggcgcctgtcccgggtgctgcgggagctggacctccaagtgctggacacccgcatgtgtaacaacagccgcttctggaacggcagcctctcccccagcatggtctgcctggcggccgactccaaggaccaggctccctgcaagggtgactcgggcgggcccctggtgtgtggcaaaggccgggtgttggccggagtcctgtccttcagctccagggtctgcactgacatcttcaagcctcccgtggccaccgctgtggcgccttacgtgtcctggatcaggaaggtcaccggccgatcggcctgatgccctggggtgatggggaccccctcgctgtctccacaggacccttcccctccaggggtgcagtggggtgggtgaggacgggtgggagggacagggagggaccaataaatcataatgaagaaacgctcaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3004 -> Molecular function: GO:0004252 [serine-type endopeptidase activity] evidence: IEA
GeneID:3004 -> Molecular function: GO:0008236 [serine-type peptidase activity] evidence: TAS
GeneID:3004 -> Biological process: GO:0006508 [proteolysis] evidence: IEA
GeneID:3004 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:3004 -> Biological process: GO:0019835 [cytolysis] evidence: IEA
GeneID:3004 -> Biological process: GO:0045087 [innate immune response] evidence: IEA
GeneID:3004 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.