2024-03-28 20:41:51, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001258003 1444 bp mRNA linear PRI 01-JUL-2013 DEFINITION Homo sapiens chitinase, acidic (CHIA), transcript variant 7, mRNA. ACCESSION NM_001258003 VERSION NM_001258003.1 GI:384367985 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1444) AUTHORS Di Rosa,M., De Gregorio,C., Malaguarnera,G., Tuttobene,M., Biazzo,F. and Malaguarnera,L. TITLE Evaluation of AMCase and CHIT-1 expression in monocyte macrophages lineage JOURNAL Mol. Cell. Biochem. 374 (1-2), 73-80 (2013) PUBMED 23129258 REMARK GeneRIF: results showed that the expression of AMCase and CHIT-1 were differently modulated in monocyte macrophages at different stage of maturation. The behavior of these two active chitinase suggests that in the immune response their role is complementary. REFERENCE 2 (bases 1 to 1444) AUTHORS Aminuddin,F., Akhabir,L., Stefanowicz,D., Pare,P.D., Connett,J.E., Anthonisen,N.R., Fahy,J.V., Seibold,M.A., Burchard,E.G., Eng,C., Gulsvik,A., Bakke,P., Cho,M.H., Litonjua,A., Lomas,D.A., Anderson,W.H., Beaty,T.H., Crapo,J.D., Silverman,E.K. and Sandford,A.J. TITLE Genetic association between human chitinases and lung function in COPD JOURNAL Hum. Genet. 131 (7), 1105-1114 (2012) PUBMED 22200767 REMARK GeneRIF: study demonstrated genetic associations between chitinase gene variants and lung function level and rate of decline in chronic obstructive pulmonary disease patients from the Lung Health Study; also functional effect of the rs3818822 polymorphism on AMCase levels and activity was demonstrated REFERENCE 3 (bases 1 to 1444) AUTHORS Birben,E., Sackesen,C., Kazani,S., Tincer,G., Karaaslan,C., Durgunsu,B., Gursel,I., Wechsler,M.E., Israel,E. and Kalayci,O. TITLE The effects of an insertion in the 5'UTR of the AMCase on gene expression and pulmonary functions JOURNAL Respir Med 105 (8), 1160-1169 (2011) PUBMED 21511453 REMARK GeneRIF: A ten base pair insertion in the second exon in the 5'UTR region of the AMCase gene may modify the gene expression and thus may affect the severity of asthma. REFERENCE 4 (bases 1 to 1444) AUTHORS Gu,Z., Cao,Z. and Jin,M. TITLE Expression and role of acidic mammalian chitinase and eotaxin-3 in chronic rhinosinusitis with nasal polyps JOURNAL J Otolaryngol Head Neck Surg 40 (1), 64-69 (2011) PUBMED 21303604 REMARK GeneRIF: AMCase and eotaxin-3 may be important mediators in the pathogenesis of nasal polyps. The increased AMCase and eotaxin-3 might lead to nasal polyp formation and growth. REFERENCE 5 (bases 1 to 1444) AUTHORS Park,S.K., Heo,K.W., Hur,D.Y. and Yang,Y.I. TITLE Chitinolytic activity in nasal polyps JOURNAL Am J Rhinol Allergy 25 (1), 12-14 (2011) PUBMED 21711963 REMARK GeneRIF: increased chitinolytic activity in nasal polyps REFERENCE 6 (bases 1 to 1444) AUTHORS Chou,Y.T., Yao,S., Czerwinski,R., Fleming,M., Krykbaev,R., Xuan,D., Zhou,H., Brooks,J., Fitz,L., Strand,J., Presman,E., Lin,L., Aulabaugh,A. and Huang,X. TITLE Kinetic characterization of recombinant human acidic mammalian chitinase JOURNAL Biochemistry 45 (14), 4444-4454 (2006) PUBMED 16584180 REMARK GeneRIF: human AMCase has only one pH optimum for k(cat)/K(m) between pH 4 and 5. Steady state kinetics shows that human AMCase has 'low' intrinsic transglycosidase activity, which leads to the observation of apparent substrate inhibition. REFERENCE 7 (bases 1 to 1444) AUTHORS Zhu,Z., Zheng,T., Homer,R.J., Kim,Y.K., Chen,N.Y., Cohn,L., Hamid,Q. and Elias,J.A. TITLE Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation JOURNAL Science 304 (5677), 1678-1682 (2004) PUBMED 15192232 REMARK GeneRIF: expressed in exaggerated quantities in human asthma REFERENCE 8 (bases 1 to 1444) AUTHORS Goto,M., Fujimoto,W., Nio,J., Iwanaga,T. and Kawasaki,T. TITLE Immunohistochemical demonstration of acidic mammalian chitinase in the mouse salivary gland and gastric mucosa JOURNAL Arch. Oral Biol. 48 (10), 701-707 (2003) PUBMED 12971947 REFERENCE 9 (bases 1 to 1444) AUTHORS Boot,R.G., Blommaart,E.F., Swart,E., Ghauharali-van der Vlugt,K., Bijl,N., Moe,C., Place,A. and Aerts,J.M. TITLE Identification of a novel acidic mammalian chitinase distinct from chitotriosidase JOURNAL J. Biol. Chem. 276 (9), 6770-6778 (2001) PUBMED 11085997 REFERENCE 10 (bases 1 to 1444) AUTHORS Saito,A., Ozaki,K., Fujiwara,T., Nakamura,Y. and Tanigami,A. TITLE Isolation and mapping of a human lung-specific gene, TSA1902, encoding a novel chitinase family member JOURNAL Gene 239 (2), 325-331 (1999) PUBMED 10548734 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK290702.1, AY825504.1 and BC036339.1. Summary: The protein encoded by this gene degrades chitin, which is found in the cell wall of most fungi as well as in arthropods and some nematodes. The encoded protein can also stimulate interleukin 13 expression, and variations in this gene can lead to asthma susceptibility. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]. Transcript Variant: This variant (7) lacks exons in the 5' coding region and initiates translation at a downstream AUG compared to variant 4. The encoded isoform (a, also known as TSA1902-L) has a shorter N-terminus and lacks a signal peptide compared to isoform c. Variants 2, 5, and 7 all encode the same isoform (a). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AY825504.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 AK290702.1 1-10 11-245 AY825504.1 1-235 246-1444 BC036339.1 154-1352 FEATURES Location/Qualifiers source 1..1444 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p13.2" gene 1..1444 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="chitinase, acidic" /db_xref="GeneID:27159" /db_xref="HGNC:17432" /db_xref="MIM:606080" exon 1..99 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 16..18 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="ct" /db_xref="dbSNP:34698010" variation 16..17 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="ct" /db_xref="dbSNP:374234404" variation 22 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:116488064" variation 44 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:12026825" variation 72 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:149411814" variation 75 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:146385552" variation 88 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139768111" variation 97 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:142723581" exon 100..129 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" exon 130..186 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 133 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368828123" variation 140 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:143910053" variation 169 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:147282128" variation 176 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:3818822" variation 186 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:201556508" exon 187..352 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" CDS 197..1303 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /EC_number="3.2.1.14" /note="isoform a is encoded by transcript variant 7; acidic mammalian chitinase; lung-specific protein TSA1902" /codon_start=1 /product="acidic mammalian chitinase isoform a" /protein_id="NP_001244932.1" /db_xref="GI:384367986" /db_xref="CCDS:CCDS832.1" /db_xref="GeneID:27159" /db_xref="HGNC:17432" /db_xref="MIM:606080" /translation="
MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
" misc_feature <197..1033 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have...; Region: GH18_chitinase-like; cl10447" /db_xref="CDD:209141" misc_feature <197..967 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="Glyco_18 domain; Region: Glyco_18; smart00636" /db_xref="CDD:197811" misc_feature order(278..280,284..286,290..292,506..511,671..673, 950..952) /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="active site" /db_xref="CDD:119349" misc_feature 1157..1300 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="Chitin-binding domain type 2; Region: ChtBD2; smart00494" /db_xref="CDD:197759" variation 219 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:146209261" variation 223 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:150698600" variation 240 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:377228357" variation 246 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:61756687" variation 250 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:41282498" variation 251 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:369223512" variation 255 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:140031055" variation 259 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:200273853" variation 271 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:140252614" variation 290 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="g" /db_xref="dbSNP:144029730" variation 305 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:188294966" variation 309 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:142253415" variation 315 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:373203725" variation 346 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:146460083" variation 348 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:199990081" exon 353..477 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 359 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139158262" variation 374 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:199860140" variation 377 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:143586120" variation 387 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:144679403" variation 389 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="t" /db_xref="dbSNP:116430435" variation 394 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:200617710" variation 414 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:377181497" variation 437 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:369860168" variation 452 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:199874052" variation 467 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="c" /db_xref="dbSNP:150563512" exon 478..601 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 484 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:140904700" variation 496 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368843945" variation 508 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:148384495" variation 509 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:200134913" variation 565 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:369614927" variation 567 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:376497990" variation 572 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:147103194" variation 577 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:143960572" variation 586 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139759326" variation 587 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:142137716" variation 593 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:151297358" exon 602..787 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 625 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:114510939" variation 629 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="t" /db_xref="dbSNP:181434663" variation 656 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:367730751" variation 683 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:78293817" variation 688 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:139093708" variation 697 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:143107428" variation 699 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:371506503" variation 704 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:143732960" variation 720 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:150309903" variation 735 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:61748620" variation 745 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:61748619" variation 755 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:79500525" variation 761 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:139420194" variation 763 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:201390788" variation 774 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:150840174" variation 785 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:201266629" exon 788..907 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 795 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:142736771" variation 822 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:139812869" variation 828..829 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="tgcccctcaggaag" /db_xref="dbSNP:151326722" variation 830 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:200566957" variation 832..833 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="cctcaggaagtgcc" /db_xref="dbSNP:375881947" variation 846 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="cctcaggaagtgcc" /db_xref="dbSNP:74706064" variation 865 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:144546962" variation 866 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:375947945" variation 868 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:17027410" variation 869 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:190772785" variation 871 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:144182515" variation 880 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:370020615" variation 886 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:182916944" variation 887 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:2275253" variation 894 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:189146821" variation 898 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:200092579" variation 902 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:374270214" exon 908..1049 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 933 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:2275254" variation 940 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:151038298" variation 941 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:201691527" variation 942 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:374315938" variation 944 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:142800191" variation 954 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:373985805" variation 969 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:141843885" variation 985 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:76395847" variation 1001 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:36011905" variation 1015 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368203516" variation 1023 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:143969273" variation 1028 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:147768976" variation 1033 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:2820092" variation 1034 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:371701062" variation 1037 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:12094378" exon 1050..1403 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 1057 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:372590829" variation 1064 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:140459744" variation 1078 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:199879175" variation 1087 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:377085074" variation 1090 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:150421495" variation 1092 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:145023911" variation 1093 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="t" /db_xref="dbSNP:187769579" variation 1104 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:144623576" variation 1112 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:199811046" variation 1113 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:141747675" variation 1118 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:138227985" variation 1138 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:376164222" variation 1144 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:35242709" variation 1148 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:149869566" variation 1167 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:2256721" variation 1180 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:369442393" variation 1187 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:368010768" variation 1188 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:143551303" variation 1190 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:138073907" variation 1209 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:201456008" variation 1213 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368211379" variation 1249 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:145057685" variation 1258 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:140461957" variation 1259 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:142653250" variation 1298 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:146040153" variation 1320 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:373720681" variation 1325 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139802202" variation 1337 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:372826781" variation 1342 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:141163072" polyA_signal 1379..1384 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" polyA_site 1403 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" ORIGIN
aaagcttcatgaaacctcctcgtctgtgcacgaacaggtggccgactctggagcccaggctgttgctttccagtctggtggtgaatcctccatagtctggtcttgtccttatactgaatttgcagctcggaacagccagctgaaaactctcctggccattggaggctggaacttcgggactgcccctttcactgccatggtttctactcctgagaaccgccagactttcatcacctcagtcatcaaattcctgcgccagtatgagtttgacgggctggactttgactgggagtaccctggctctcgtgggagccctcctcaggacaagcatctcttcactgtcctggtgcaggaaatgcgtgaagcttttgagcaggaggccaagcagatcaacaagcccaggctgatggtcactgctgcagtagctgctggcatctccaatatccagtctggctatgagatcccccaactgtcacagtacctggactacatccatgtcatgacctacgacctccatggctcctgggagggctacactggagagaacagccccctctacaaatacccgactgacaccggcagcaacgcctacctcaatgtggattatgtcatgaactactggaaggacaatggagcaccagctgagaagctcatcgttggattccctacctatggacacaacttcatcctgagcaacccctccaacactggaattggtgcccccacctctggtgctggtcctgctgggccctatgccaaggagtctgggatctgggcttactacgagatctgtaccttcctgaaaaatggagccactcagggatgggatgcccctcaggaagtgccttatgcctatcagggcaatgtgtgggttggctatgacaacatcaagagcttcgatattaaggctcaatggcttaagcacaacaaatttggaggcgccatggtctgggccattgatctggatgacttcactggcactttctgcaaccagggcaagtttcccctaatctccaccctgaagaaggccctcggcctgcagagtgcaagttgcacggctccagctcagcccattgagccaataactgctgctcccagtggcagcgggaacgggagcgggagtagcagctctggaggcagctcgggaggcagtggattctgtgctgtcagagccaacggcctctaccccgtggcaaataacagaaatgccttctggcactgcgtgaatggagtcacgtaccagcagaactgccaggccgggcttgtcttcgacaccagctgtgattgctgcaactgggcataaacctgacctggtctatattccctagagttccagtctcttttgcttaggacatgttgcccctacctaaagtcctgcaataaaatcagcagtcaaaacatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:27159 -> Molecular function: GO:0003796 [lysozyme activity] evidence: NAS GeneID:27159 -> Molecular function: GO:0004568 [chitinase activity] evidence: IDA GeneID:27159 -> Molecular function: GO:0004568 [chitinase activity] evidence: NAS GeneID:27159 -> Molecular function: GO:0008061 [chitin binding] evidence: TAS GeneID:27159 -> Molecular function: GO:0019900 [kinase binding] evidence: IPI GeneID:27159 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: NAS GeneID:27159 -> Biological process: GO:0000272 [polysaccharide catabolic process] evidence: IEA GeneID:27159 -> Biological process: GO:0001101 [response to acid] evidence: TAS GeneID:27159 -> Biological process: GO:0002532 [production of molecular mediator involved in inflammatory response] evidence: IDA GeneID:27159 -> Biological process: GO:0006030 [chitin metabolic process] evidence: NAS GeneID:27159 -> Biological process: GO:0006032 [chitin catabolic process] evidence: IDA GeneID:27159 -> Biological process: GO:0006032 [chitin catabolic process] evidence: NAS GeneID:27159 -> Biological process: GO:0006037 [cell wall chitin metabolic process] evidence: TAS GeneID:27159 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:27159 -> Biological process: GO:0006955 [immune response] evidence: NAS GeneID:27159 -> Biological process: GO:0007586 [digestion] evidence: NAS GeneID:27159 -> Biological process: GO:0009620 [response to fungus] evidence: TAS GeneID:27159 -> Biological process: GO:0090197 [positive regulation of chemokine secretion] evidence: IDA GeneID:27159 -> Cellular component: GO:0005615 [extracellular space] evidence: IC GeneID:27159 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA GeneID:27159 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS GeneID:27159 -> Cellular component: GO:0005737 [cytoplasm] evidence: NAS ANNOTATIONS from NCBI Entrez Gene (20130726): NP_001244932 -> EC 3.2.1.14
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.