Home |
Help |
Advanced search
2024-04-25 14:32:12, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001258001 1537 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens chitinase, acidic (CHIA), transcript variant 5, mRNA.
ACCESSION NM_001258001
VERSION NM_001258001.1 GI:384367981
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1537)
AUTHORS Di Rosa,M., De Gregorio,C., Malaguarnera,G., Tuttobene,M.,
Biazzo,F. and Malaguarnera,L.
TITLE Evaluation of AMCase and CHIT-1 expression in monocyte macrophages
lineage
JOURNAL Mol. Cell. Biochem. 374 (1-2), 73-80 (2013)
PUBMED 23129258
REMARK GeneRIF: results showed that the expression of AMCase and CHIT-1
were differently modulated in monocyte macrophages at different
stage of maturation. The behavior of these two active chitinase
suggests that in the immune response their role is complementary.
REFERENCE 2 (bases 1 to 1537)
AUTHORS Aminuddin,F., Akhabir,L., Stefanowicz,D., Pare,P.D., Connett,J.E.,
Anthonisen,N.R., Fahy,J.V., Seibold,M.A., Burchard,E.G., Eng,C.,
Gulsvik,A., Bakke,P., Cho,M.H., Litonjua,A., Lomas,D.A.,
Anderson,W.H., Beaty,T.H., Crapo,J.D., Silverman,E.K. and
Sandford,A.J.
TITLE Genetic association between human chitinases and lung function in
COPD
JOURNAL Hum. Genet. 131 (7), 1105-1114 (2012)
PUBMED 22200767
REMARK GeneRIF: study demonstrated genetic associations between chitinase
gene variants and lung function level and rate of decline in
chronic obstructive pulmonary disease patients from the Lung Health
Study; also functional effect of the rs3818822 polymorphism on
AMCase levels and activity was demonstrated
REFERENCE 3 (bases 1 to 1537)
AUTHORS Birben,E., Sackesen,C., Kazani,S., Tincer,G., Karaaslan,C.,
Durgunsu,B., Gursel,I., Wechsler,M.E., Israel,E. and Kalayci,O.
TITLE The effects of an insertion in the 5'UTR of the AMCase on gene
expression and pulmonary functions
JOURNAL Respir Med 105 (8), 1160-1169 (2011)
PUBMED 21511453
REMARK GeneRIF: A ten base pair insertion in the second exon in the 5'UTR
region of the AMCase gene may modify the gene expression and thus
may affect the severity of asthma.
REFERENCE 4 (bases 1 to 1537)
AUTHORS Gu,Z., Cao,Z. and Jin,M.
TITLE Expression and role of acidic mammalian chitinase and eotaxin-3 in
chronic rhinosinusitis with nasal polyps
JOURNAL J Otolaryngol Head Neck Surg 40 (1), 64-69 (2011)
PUBMED 21303604
REMARK GeneRIF: AMCase and eotaxin-3 may be important mediators in the
pathogenesis of nasal polyps. The increased AMCase and eotaxin-3
might lead to nasal polyp formation and growth.
REFERENCE 5 (bases 1 to 1537)
AUTHORS Park,S.K., Heo,K.W., Hur,D.Y. and Yang,Y.I.
TITLE Chitinolytic activity in nasal polyps
JOURNAL Am J Rhinol Allergy 25 (1), 12-14 (2011)
PUBMED 21711963
REMARK GeneRIF: increased chitinolytic activity in nasal polyps
REFERENCE 6 (bases 1 to 1537)
AUTHORS Chou,Y.T., Yao,S., Czerwinski,R., Fleming,M., Krykbaev,R., Xuan,D.,
Zhou,H., Brooks,J., Fitz,L., Strand,J., Presman,E., Lin,L.,
Aulabaugh,A. and Huang,X.
TITLE Kinetic characterization of recombinant human acidic mammalian
chitinase
JOURNAL Biochemistry 45 (14), 4444-4454 (2006)
PUBMED 16584180
REMARK GeneRIF: human AMCase has only one pH optimum for k(cat)/K(m)
between pH 4 and 5. Steady state kinetics shows that human AMCase
has 'low' intrinsic transglycosidase activity, which leads to the
observation of apparent substrate inhibition.
REFERENCE 7 (bases 1 to 1537)
AUTHORS Zhu,Z., Zheng,T., Homer,R.J., Kim,Y.K., Chen,N.Y., Cohn,L.,
Hamid,Q. and Elias,J.A.
TITLE Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13
pathway activation
JOURNAL Science 304 (5677), 1678-1682 (2004)
PUBMED 15192232
REMARK GeneRIF: expressed in exaggerated quantities in human asthma
REFERENCE 8 (bases 1 to 1537)
AUTHORS Goto,M., Fujimoto,W., Nio,J., Iwanaga,T. and Kawasaki,T.
TITLE Immunohistochemical demonstration of acidic mammalian chitinase in
the mouse salivary gland and gastric mucosa
JOURNAL Arch. Oral Biol. 48 (10), 701-707 (2003)
PUBMED 12971947
REFERENCE 9 (bases 1 to 1537)
AUTHORS Boot,R.G., Blommaart,E.F., Swart,E., Ghauharali-van der Vlugt,K.,
Bijl,N., Moe,C., Place,A. and Aerts,J.M.
TITLE Identification of a novel acidic mammalian chitinase distinct from
chitotriosidase
JOURNAL J. Biol. Chem. 276 (9), 6770-6778 (2001)
PUBMED 11085997
REFERENCE 10 (bases 1 to 1537)
AUTHORS Saito,A., Ozaki,K., Fujiwara,T., Nakamura,Y. and Tanigami,A.
TITLE Isolation and mapping of a human lung-specific gene, TSA1902,
encoding a novel chitinase family member
JOURNAL Gene 239 (2), 325-331 (1999)
PUBMED 10548734
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK290702.1, AL513202.22 and
BC036339.1.
Summary: The protein encoded by this gene degrades chitin, which is
found in the cell wall of most fungi as well as in arthropods and
some nematodes. The encoded protein can also stimulate interleukin
13 expression, and variations in this gene can lead to asthma
susceptibility. Several transcript variants encoding a few
different isoforms have been found for this gene. [provided by
RefSeq, Apr 2012].
Transcript Variant: This variant (5) lacks an exon in the 5' coding
region and initiates translation at a downstream AUG compared to
variant 4. The encoded isoform (a, also known as TSA1902-L) has a
shorter N-terminus and lacks a signal peptide compared to isoform
c. Variants 2, 5, and 7 all encode the same isoform (a).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK290702.1, AY789444.1 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-18 AK290702.1 1-18
19-43 AK290702.1 21-45
44-44 AL513202.22 71246-71246
45-320 AK290702.1 47-322
321-1537 BC036339.1 136-1352
FEATURES Location/Qualifiers
source 1..1537
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1p13.2"
gene 1..1537
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/note="chitinase, acidic"
/db_xref="GeneID:27159"
/db_xref="HGNC:17432"
/db_xref="MIM:606080"
exon 1..99
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 16..18
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="ct"
/db_xref="dbSNP:34698010"
variation 16..17
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="ct"
/db_xref="dbSNP:374234404"
variation 22
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:116488064"
variation 44
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:12026825"
variation 72
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:149411814"
variation 75
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:146385552"
variation 88
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:139768111"
variation 97
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:142723581"
misc_feature 98..100
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/note="upstream in-frame stop codon"
exon 100..192
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 103
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:193167990"
variation 123
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:376415475"
variation 126
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:367796033"
variation 131
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:371120238"
variation 134
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:200693541"
variation 136..137
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="aagcc"
/db_xref="dbSNP:201649523"
variation 137..138
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="agccaatct"
/db_xref="dbSNP:200345479"
variation 138..139
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="gccaatctag"
/db_xref="dbSNP:143789088"
variation 140..141
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="caatctaggc"
/db_xref="dbSNP:375930070"
variation 146
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:374220212"
variation 151
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:201988572"
variation 155
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:17027394"
variation 163
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:376159900"
variation 165
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:200929969"
variation 166
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:373861430"
variation 170
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:368020028"
variation 178
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:371398270"
variation 182
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:200053948"
variation 185
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:375003916"
exon 193..222
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
exon 223..279
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 226
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:368828123"
variation 233
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/db_xref="dbSNP:143910053"
variation 262
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:147282128"
variation 269
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:3818822"
variation 279
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:201556508"
exon 280..445
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
CDS 290..1396
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/EC_number="3.2.1.14"
/note="isoform a is encoded by transcript variant 5;
acidic mammalian chitinase; lung-specific protein TSA1902"
/codon_start=1
/product="acidic mammalian chitinase isoform a"
/protein_id="NP_001244930.1"
/db_xref="GI:384367982"
/db_xref="CCDS:CCDS832.1"
/db_xref="GeneID:27159"
/db_xref="HGNC:17432"
/db_xref="MIM:606080"
/translation="
MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
"
misc_feature <290..1126
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/note="The GH18 (glycosyl hydrolase, family 18) type II
chitinases hydrolyze chitin, an abundant polymer of
beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a
major component of the cell wall of fungi and the
exoskeleton of arthropods. Chitinases have...; Region:
GH18_chitinase-like; cl10447"
/db_xref="CDD:209141"
misc_feature <290..1060
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/note="Glyco_18 domain; Region: Glyco_18; smart00636"
/db_xref="CDD:197811"
misc_feature order(371..373,377..379,383..385,599..604,764..766,
1043..1045)
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/note="active site"
/db_xref="CDD:119349"
misc_feature 1250..1393
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/note="Chitin-binding domain type 2; Region: ChtBD2;
smart00494"
/db_xref="CDD:197759"
variation 312
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:146209261"
variation 316
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:150698600"
variation 333
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:377228357"
variation 339
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:61756687"
variation 343
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/db_xref="dbSNP:41282498"
variation 344
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:369223512"
variation 348
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:140031055"
variation 352
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:200273853"
variation 364
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:140252614"
variation 383
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="g"
/db_xref="dbSNP:144029730"
variation 398
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:188294966"
variation 402
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:142253415"
variation 408
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:373203725"
variation 439
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:146460083"
variation 441
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:199990081"
exon 446..570
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 452
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:139158262"
variation 467
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:199860140"
variation 470
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:143586120"
variation 480
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:144679403"
variation 482
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="t"
/db_xref="dbSNP:116430435"
variation 487
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/db_xref="dbSNP:200617710"
variation 507
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:377181497"
variation 530
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:369860168"
variation 545
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:199874052"
variation 560
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="c"
/db_xref="dbSNP:150563512"
exon 571..694
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 577
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:140904700"
variation 589
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:368843945"
variation 601
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:148384495"
variation 602
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:200134913"
variation 658
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:369614927"
variation 660
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:376497990"
variation 665
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:147103194"
variation 670
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:143960572"
variation 679
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:139759326"
variation 680
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:142137716"
variation 686
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:151297358"
exon 695..880
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 718
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:114510939"
variation 722
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="t"
/db_xref="dbSNP:181434663"
variation 749
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:367730751"
variation 776
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:78293817"
variation 781
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/db_xref="dbSNP:139093708"
variation 790
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:143107428"
variation 792
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:371506503"
variation 797
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:143732960"
variation 813
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:150309903"
variation 828
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:61748620"
variation 838
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:61748619"
variation 848
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:79500525"
variation 854
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:139420194"
variation 856
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:201390788"
variation 867
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:150840174"
variation 878
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:201266629"
exon 881..1000
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 888
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:142736771"
variation 915
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:139812869"
variation 921..922
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="tgcccctcaggaag"
/db_xref="dbSNP:151326722"
variation 923
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:200566957"
variation 925..926
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="cctcaggaagtgcc"
/db_xref="dbSNP:375881947"
variation 939
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace=""
/replace="cctcaggaagtgcc"
/db_xref="dbSNP:74706064"
variation 958
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:144546962"
variation 959
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:375947945"
variation 961
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:17027410"
variation 962
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:190772785"
variation 964
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:144182515"
variation 973
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:370020615"
variation 979
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:182916944"
variation 980
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:2275253"
variation 987
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:189146821"
variation 991
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:200092579"
variation 995
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:374270214"
exon 1001..1142
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 1026
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:2275254"
variation 1033
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:151038298"
variation 1034
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:201691527"
variation 1035
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:374315938"
variation 1037
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:142800191"
variation 1047
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:373985805"
variation 1062
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:141843885"
variation 1078
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:76395847"
variation 1094
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:36011905"
variation 1108
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:368203516"
variation 1116
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:143969273"
variation 1121
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:147768976"
variation 1126
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:2820092"
variation 1127
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:371701062"
variation 1130
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:12094378"
exon 1143..1496
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/inference="alignment:Splign:1.39.8"
variation 1150
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:372590829"
variation 1157
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:140459744"
variation 1171
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:199879175"
variation 1180
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:377085074"
variation 1183
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:150421495"
variation 1185
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:145023911"
variation 1186
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="t"
/db_xref="dbSNP:187769579"
variation 1197
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:144623576"
variation 1205
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:199811046"
variation 1206
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:141747675"
variation 1211
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:138227985"
variation 1231
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/db_xref="dbSNP:376164222"
variation 1237
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:35242709"
variation 1241
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:149869566"
variation 1260
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:2256721"
variation 1273
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/db_xref="dbSNP:369442393"
variation 1280
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="c"
/db_xref="dbSNP:368010768"
variation 1281
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:143551303"
variation 1283
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:138073907"
variation 1302
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:201456008"
variation 1306
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:368211379"
variation 1342
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="g"
/db_xref="dbSNP:145057685"
variation 1351
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:140461957"
variation 1352
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:142653250"
variation 1391
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:146040153"
variation 1413
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="a"
/replace="g"
/db_xref="dbSNP:373720681"
variation 1418
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:139802202"
variation 1430
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="c"
/replace="t"
/db_xref="dbSNP:372826781"
variation 1435
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
/replace="g"
/replace="t"
/db_xref="dbSNP:141163072"
polyA_signal 1472..1477
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
polyA_site 1496
/gene="CHIA"
/gene_synonym="AMCASE; CHIT2; TSA1902"
ORIGIN
aaagcttcatgaaacctcctcgtctgtgcacgaacaggtggccgactctggagcccaggctgttgctttccagtctggtggtgaatcctccatagtctgaagcctttgtgataaccacagaatcagaacatataaaaagctctgcgggactggtgctgactgcaaccatgacaaagcttattctcctcacaggtcttgtccttatactgaatttgcagctcggaacagccagctgaaaactctcctggccattggaggctggaacttcgggactgcccctttcactgccatggtttctactcctgagaaccgccagactttcatcacctcagtcatcaaattcctgcgccagtatgagtttgacgggctggactttgactgggagtaccctggctctcgtgggagccctcctcaggacaagcatctcttcactgtcctggtgcaggaaatgcgtgaagcttttgagcaggaggccaagcagatcaacaagcccaggctgatggtcactgctgcagtagctgctggcatctccaatatccagtctggctatgagatcccccaactgtcacagtacctggactacatccatgtcatgacctacgacctccatggctcctgggagggctacactggagagaacagccccctctacaaatacccgactgacaccggcagcaacgcctacctcaatgtggattatgtcatgaactactggaaggacaatggagcaccagctgagaagctcatcgttggattccctacctatggacacaacttcatcctgagcaacccctccaacactggaattggtgcccccacctctggtgctggtcctgctgggccctatgccaaggagtctgggatctgggcttactacgagatctgtaccttcctgaaaaatggagccactcagggatgggatgcccctcaggaagtgccttatgcctatcagggcaatgtgtgggttggctatgacaacatcaagagcttcgatattaaggctcaatggcttaagcacaacaaatttggaggcgccatggtctgggccattgatctggatgacttcactggcactttctgcaaccagggcaagtttcccctaatctccaccctgaagaaggccctcggcctgcagagtgcaagttgcacggctccagctcagcccattgagccaataactgctgctcccagtggcagcgggaacgggagcgggagtagcagctctggaggcagctcgggaggcagtggattctgtgctgtcagagccaacggcctctaccccgtggcaaataacagaaatgccttctggcactgcgtgaatggagtcacgtaccagcagaactgccaggccgggcttgtcttcgacaccagctgtgattgctgcaactgggcataaacctgacctggtctatattccctagagttccagtctcttttgcttaggacatgttgcccctacctaaagtcctgcaataaaatcagcagtcaaaacatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:27159 -> Molecular function: GO:0003796 [lysozyme activity] evidence: NAS
GeneID:27159 -> Molecular function: GO:0004568 [chitinase activity] evidence: IDA
GeneID:27159 -> Molecular function: GO:0004568 [chitinase activity] evidence: NAS
GeneID:27159 -> Molecular function: GO:0008061 [chitin binding] evidence: TAS
GeneID:27159 -> Molecular function: GO:0019900 [kinase binding] evidence: IPI
GeneID:27159 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: NAS
GeneID:27159 -> Biological process: GO:0000272 [polysaccharide catabolic process] evidence: IEA
GeneID:27159 -> Biological process: GO:0001101 [response to acid] evidence: TAS
GeneID:27159 -> Biological process: GO:0002532 [production of molecular mediator involved in inflammatory response] evidence: IDA
GeneID:27159 -> Biological process: GO:0006030 [chitin metabolic process] evidence: NAS
GeneID:27159 -> Biological process: GO:0006032 [chitin catabolic process] evidence: IDA
GeneID:27159 -> Biological process: GO:0006032 [chitin catabolic process] evidence: NAS
GeneID:27159 -> Biological process: GO:0006037 [cell wall chitin metabolic process] evidence: TAS
GeneID:27159 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:27159 -> Biological process: GO:0006955 [immune response] evidence: NAS
GeneID:27159 -> Biological process: GO:0007586 [digestion] evidence: NAS
GeneID:27159 -> Biological process: GO:0009620 [response to fungus] evidence: TAS
GeneID:27159 -> Biological process: GO:0090197 [positive regulation of chemokine secretion] evidence: IDA
GeneID:27159 -> Cellular component: GO:0005615 [extracellular space] evidence: IC
GeneID:27159 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
GeneID:27159 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS
GeneID:27159 -> Cellular component: GO:0005737 [cytoplasm] evidence: NAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001244930 -> EC 3.2.1.14
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.