Home |
Help |
Advanced search
2024-04-19 11:49:47, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001257118 2019 bp mRNA linear PRI 02-JUN-2013
DEFINITION Homo sapiens caspase 1, apoptosis-related cysteine peptidase
(CASP1), transcript variant 6, mRNA.
ACCESSION NM_001257118
VERSION NM_001257118.1 GI:380254456
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2019)
AUTHORS Datta,D., McClendon,C.L., Jacobson,M.P. and Wells,J.A.
TITLE Substrate and inhibitor-induced dimerization and cooperativity in
caspase-1 but not caspase-3
JOURNAL J. Biol. Chem. 288 (14), 9971-9981 (2013)
PUBMED 23386603
REMARK GeneRIF: Substrate and inhibitor-induced dimerization and
cooperativity in caspase-1 but not caspase-3
REFERENCE 2 (bases 1 to 2019)
AUTHORS Savaryn,J.P., Reitsma,J.M., Bigley,T.M., Halligan,B.D., Qian,Z.,
Yu,D. and Terhune,S.S.
TITLE Human cytomegalovirus pUL29/28 and pUL38 repression of
p53-regulated p21CIP1 and caspase 1 promoters during infection
JOURNAL J. Virol. 87 (5), 2463-2474 (2013)
PUBMED 23236067
REMARK GeneRIF: during cytomegalovirus infection, pUL29/28 and pUL38
contributed to inhibition of p21CIP1 and caspase 1 expression;
expression of pUL29/28 and pUL38 contributed to an increase in
steady-state levels of p53; study identified 2 additional HCMV
proteins, pUL29/28 and pUL38, which participate in regulation of
p53 transcription activity
REFERENCE 3 (bases 1 to 2019)
AUTHORS Lopez-Castejon,G., Luheshi,N.M., Compan,V., High,S.,
Whitehead,R.C., Flitsch,S., Kirov,A., Prudovsky,I., Swanton,E. and
Brough,D.
TITLE Deubiquitinases regulate the activity of caspase-1 and
interleukin-1beta secretion via assembly of the inflammasome
JOURNAL J. Biol. Chem. 288 (4), 2721-2733 (2013)
PUBMED 23209292
REMARK GeneRIF: Deubiquitinases regulate the activity of caspase-1 and
interleukin-1beta secretion via assembly of the inflammasome
REFERENCE 4 (bases 1 to 2019)
AUTHORS Bauer,R.N., Brighton,L.E., Mueller,L., Xiang,Z., Rager,J.E.,
Fry,R.C., Peden,D.B. and Jaspers,I.
TITLE Influenza enhances caspase-1 in bronchial epithelial cells from
asthmatic volunteers and is associated with pathogenesis
JOURNAL J. Allergy Clin. Immunol. 130 (4), 958-967 (2012)
PUBMED 23021143
REMARK GeneRIF: Caspase-1 plays an important role in the airway epithelial
cell response to influenza infection, which is enhanced in
asthmatic volunteers, and may contribute to the enhanced
influenza-related pathogenesis observed in vivo.
REFERENCE 5 (bases 1 to 2019)
AUTHORS Wang,Y., He,Y., Abraham,B., Rouhani,F.N., Brantly,M.L., Scott,D.E.
and Reed,J.L.
TITLE Cytosolic, autocrine alpha-1 proteinase inhibitor (A1PI) inhibits
caspase-1 and blocks IL-1beta dependent cytokine release in
monocytes
JOURNAL PLoS ONE 7 (11), E51078 (2012)
PUBMED 23226468
REMARK GeneRIF: Monocyte/macrophage-expressed A1PI-M antagonizes IL-1beta
secretion possibly via caspase-1 inhibition.
REFERENCE 6 (bases 1 to 2019)
AUTHORS Gu,Y., Sarnecki,C., Aldape,R.A., Livingston,D.J. and Su,M.S.
TITLE Cleavage of poly(ADP-ribose) polymerase by interleukin-1 beta
converting enzyme and its homologs TX and Nedd-2
JOURNAL J. Biol. Chem. 270 (32), 18715-18718 (1995)
PUBMED 7642516
REFERENCE 7 (bases 1 to 2019)
AUTHORS Kronheim,S.R., Mumma,A., Greenstreet,T., Glackin,P.J., Van Ness,K.,
March,C.J. and Black,R.A.
TITLE Purification of interleukin-1 beta converting enzyme, the protease
that cleaves the interleukin-1 beta precursor
JOURNAL Arch. Biochem. Biophys. 296 (2), 698-703 (1992)
PUBMED 1321594
REFERENCE 8 (bases 1 to 2019)
AUTHORS Thornberry,N.A., Bull,H.G., Calaycay,J.R., Chapman,K.T.,
Howard,A.D., Kostura,M.J., Miller,D.K., Molineaux,S.M.,
Weidner,J.R., Aunins,J. et al.
TITLE A novel heterodimeric cysteine protease is required for
interleukin-1 beta processing in monocytes
JOURNAL Nature 356 (6372), 768-774 (1992)
PUBMED 1574116
REFERENCE 9 (bases 1 to 2019)
AUTHORS Cerretti,D.P., Kozlosky,C.J., Mosley,B., Nelson,N., Van Ness,K.,
Greenstreet,T.A., March,C.J., Kronheim,S.R., Druck,T.,
Cannizzaro,L.A. et al.
TITLE Molecular cloning of the interleukin-1 beta converting enzyme
JOURNAL Science 256 (5053), 97-100 (1992)
PUBMED 1373520
REFERENCE 10 (bases 1 to 2019)
AUTHORS Howard,A.D., Kostura,M.J., Thornberry,N., Ding,G.J., Limjuco,G.,
Weidner,J., Salley,J.P., Hogquist,K.A., Chaplin,D.D., Mumford,R.A.
et al.
TITLE IL-1-converting enzyme requires aspartic acid residues for
processing of the IL-1 beta precursor at two distinct sites and
does not cleave 31-kDa IL-1 alpha
JOURNAL J. Immunol. 147 (9), 2964-2969 (1991)
PUBMED 1919001
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AP001153.5, AK290114.1 and
AA737419.1.
Summary: This gene encodes a protein which is a member of the
cysteine-aspartic acid protease (caspase) family. Sequential
activation of caspases plays a central role in the execution-phase
of cell apoptosis. Caspases exist as inactive proenzymes which
undergo proteolytic processing at conserved aspartic residues to
produce 2 subunits, large and small, that dimerize to form the
active enzyme. This gene was identified by its ability to
proteolytically cleave and activate the inactive precursor of
interleukin-1, a cytokine involved in the processes such as
inflammation, septic shock, and wound healing. This gene has been
shown to induce cell apoptosis and may function in various
developmental stages. Studies of a similar gene in mouse suggest a
role in the pathogenesis of Huntington disease. Alternative
splicing results in transcript variants encoding distinct isoforms.
[provided by RefSeq, Mar 2012].
Transcript Variant: This variant (6) differs in the 3' UTR compared
to variant alpha. Variant alpha and variant 6 encode the same
protein.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK223503.1, AK290114.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-10 AP001153.5 73087-73096 c
11-981 AK290114.1 2-972
982-982 AP001153.5 67131-67131 c
983-1521 AK290114.1 974-1512
1522-1878 AP001153.5 63578-63934 c
1879-2019 AA737419.1 1-141 c
FEATURES Location/Qualifiers
source 1..2019
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q23"
gene 1..2019
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/note="caspase 1, apoptosis-related cysteine peptidase"
/db_xref="GeneID:834"
/db_xref="HGNC:1499"
/db_xref="MIM:147678"
exon 1..51
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
CDS 45..1259
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/EC_number="3.4.22.36"
/note="isoform alpha precursor is encoded by transcript
variant 6; interleukin 1-B converting enzyme;
IL1B-convertase; CASP1 nirs variant 1; IL-1
beta-converting enzyme; caspase 1, apoptosis-related
cysteine peptidase (interleukin 1, beta, convertase)"
/codon_start=1
/product="caspase-1 isoform alpha precursor"
/protein_id="NP_001244047.1"
/db_xref="GI:380254457"
/db_xref="CCDS:CCDS8330.1"
/db_xref="GeneID:834"
/db_xref="HGNC:1499"
/db_xref="MIM:147678"
/translation="
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
"
misc_feature 57..305
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/note="Caspase activation and recruitment domain found in
Caspase-1 and related proteins; Region: CARD_CASP1-like;
cd08325"
/db_xref="CDD:176739"
mat_peptide 402..935
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/product="caspase-1 isoform alpha p20 subunit"
misc_feature 498..1247
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/note="Caspase, interleukin-1 beta converting enzyme (ICE)
homologues; Cysteine-dependent aspartate-directed
proteases that mediate programmed cell death (apoptosis).
Caspases are synthesized as inactive zymogens and
activated by proteolysis of the peptide...; Region: CASc;
cd00032"
/db_xref="CDD:28914"
misc_feature order(579..581,756..758,891..893,912..914,1056..1073,
1083..1088)
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/note="substrate pocket [chemical binding]; other site"
/db_xref="CDD:28914"
misc_feature order(753..755,897..899)
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/note="active site"
/db_xref="CDD:28914"
misc_feature order(915..917,1011..1016,1035..1037,1044..1046,
1053..1055,1122..1124,1146..1148,1164..1166,1194..1196,
1209..1211,1215..1217,1221..1223,1230..1235)
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:28914"
misc_feature order(918..920,1008..1010)
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/note="proteolytic cleavage site; other site"
/db_xref="CDD:28914"
mat_peptide 993..1256
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/product="caspase-1 isoform alpha p10 subunit"
exon 52..318
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
variation 88
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="a"
/replace="g"
/db_xref="dbSNP:1042743"
variation 206
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="c"
/replace="t"
/db_xref="dbSNP:539595"
exon 319..381
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
exon 382..497
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
variation 426
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="a"
/replace="g"
/db_xref="dbSNP:3203614"
variation 429
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="c"
/replace="t"
/db_xref="dbSNP:3203615"
variation 454
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="c"
/replace="t"
/db_xref="dbSNP:3203616"
exon 498..671
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
exon 672..906
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
variation 810
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="c"
/replace="t"
/db_xref="dbSNP:580253"
exon 907..1050
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
exon 1051..1160
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
STS 1064..1222
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/standard_name="IL1BCE"
/db_xref="UniSTS:43934"
exon 1161..2009
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/inference="alignment:Splign:1.39.8"
variation 1351
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="g"
/replace="t"
/db_xref="dbSNP:476889"
variation 1364
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="c"
/replace="t"
/db_xref="dbSNP:534811"
STS 1630..1762
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/standard_name="RH93671"
/db_xref="UniSTS:88476"
variation 1727
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/replace="c"
/replace="t"
/db_xref="dbSNP:488992"
STS 1934..2008
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
/standard_name="D11S4052E"
/db_xref="UniSTS:153930"
polyA_signal 1967..1972
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
polyA_signal 1985..1990
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
polyA_site 2009
/gene="CASP1"
/gene_synonym="ICE; IL1BC; P45"
ORIGIN
atactttcagtttcagtcacacaagaagggaggagagaaaagccatggccgacaaggtcctgaaggagaagagaaagctgtttatccgttccatgggtgaaggtacaataaatggcttactggatgaattattacagacaagggtgctgaacaaggaagagatggagaaagtaaaacgtgaaaatgctacagttatggataagacccgagctttgattgactccgttattccgaaaggggcacaggcatgccaaatttgcatcacatacatttgtgaagaagacagttacctggcagggacgctgggactctcagcagatcaaacatctggaaattaccttaatatgcaagactctcaaggagtactttcttcctttccagctcctcaggcagtgcaggacaacccagctatgcccacatcctcaggctcagaagggaatgtcaagctttgctccctagaagaagctcaaaggatatggaaacaaaagtcggcagagatttatccaataatggacaagtcaagccgcacacgtcttgctctcattatctgcaatgaagaatttgacagtattcctagaagaactggagctgaggttgacatcacaggcatgacaatgctgctacaaaatctggggtacagcgtagatgtgaaaaaaaatctcactgcttcggacatgactacagagctggaggcatttgcacaccgcccagagcacaagacctctgacagcacgttcctggtgttcatgtctcatggtattcgggaaggcatttgtgggaagaaacactctgagcaagtcccagatatactacaactcaatgcaatctttaacatgttgaataccaagaactgcccaagtttgaaggacaaaccgaaggtgatcatcatccaggcctgccgtggtgacagccctggtgtggtgtggtttaaagattcagtaggagtttctggaaacctatctttaccaactacagaagagtttgaggatgatgctattaagaaagcccacatagagaaggattttatcgctttctgctcttccacaccagataatgtttcttggagacatcccacaatgggctctgtttttattggaagactcattgaacatatgcaagaatatgcctgttcctgtgatgtggaggaaattttccgcaaggttcgattttcatttgagcagccagatggtagagcgcagatgcccaccactgaaagagtgactttgacaagatgtttctacctcttcccaggacattaaaataaggaaactgtatgaatgtctgtgggcaggtacatgtgtatggtcgggagtgtgggaaggttgaggaaagggtactgaaagtccatttgagtcaagaactctaggtttacaggctgagaatccttaatccaaaaatttgaattttgaaatgctctaaaatccaacactgtgtgagcgcccacatgatattcaaaggaaatgtttattgaaacatttcaaattataggtttttggattagggatgctaaaccagtaagtatacagctgaattccaatatacaaaaatatctgaaatttgaaatacttctggtagcatgcattttggataagggataatcaagccatatacagaaaatactgaagtaatgcctttcttctggtcagtgcagagcacgttgctcttctcccaaagtttttcatttagaccccttttgagattcatctgatattggcctagaagtggccgtaagactacaaaccctcacttttggatgtttctctccttcacctcagcagggtatatttaaacatagcatgtggtctttccttttaaaattgtgtatgttcccattggtggtataactttataacttgcatgtctttaaccaaattctttcctatgtttttttttttaattatttctttttctcataggaagtgaagagatccttctgtaaaggtttttggaattatgtctgctgaataataaacttttttgaaataataaatctggtagaaaaatgaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:834 -> Molecular function: GO:0004197 [cysteine-type endopeptidase activity] evidence: TAS
GeneID:834 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:834 -> Molecular function: GO:0008656 [cysteine-type endopeptidase activator activity involved in apoptotic process] evidence: TAS
GeneID:834 -> Biological process: GO:0001666 [response to hypoxia] evidence: IEA
GeneID:834 -> Biological process: GO:0006508 [proteolysis] evidence: IDA
GeneID:834 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:834 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
GeneID:834 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: TAS
GeneID:834 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:834 -> Biological process: GO:0016485 [protein processing] evidence: IEA
GeneID:834 -> Biological process: GO:0032611 [interleukin-1 beta production] evidence: IEA
GeneID:834 -> Biological process: GO:0033198 [response to ATP] evidence: IEA
GeneID:834 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS
GeneID:834 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IEP
GeneID:834 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:834 -> Biological process: GO:0050717 [positive regulation of interleukin-1 alpha secretion] evidence: IEA
GeneID:834 -> Biological process: GO:0050718 [positive regulation of interleukin-1 beta secretion] evidence: IEA
GeneID:834 -> Biological process: GO:0051882 [mitochondrial depolarization] evidence: IEA
GeneID:834 -> Biological process: GO:0060081 [membrane hyperpolarization] evidence: IEA
GeneID:834 -> Biological process: GO:0071260 [cellular response to mechanical stimulus] evidence: IEP
GeneID:834 -> Biological process: GO:0071310 [cellular response to organic substance] evidence: IDA
GeneID:834 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
GeneID:834 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:834 -> Cellular component: GO:0072557 [IPAF inflammasome complex] evidence: ISS
GeneID:834 -> Cellular component: GO:0072558 [NLRP1 inflammasome complex] evidence: IDA
GeneID:834 -> Cellular component: GO:0072559 [NLRP3 inflammasome complex] evidence: IDA
GeneID:834 -> Cellular component: GO:0097169 [AIM2 inflammasome complex] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001244047 -> EC 3.4.22.36
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.