Home |
Help |
Advanced search
2024-04-26 02:30:13, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001256192 1569 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens programmed cell death 6 interacting protein (PDCD6IP),
transcript variant 4, mRNA.
ACCESSION NM_001256192 NR_027868
VERSION NM_001256192.1 GI:371875426
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1569)
AUTHORS Dowlatshahi,D.P., Sandrin,V., Vivona,S., Shaler,T.A., Kaiser,S.E.,
Melandri,F., Sundquist,W.I. and Kopito,R.R.
TITLE ALIX is a Lys63-specific polyubiquitin binding protein that
functions in retrovirus budding
JOURNAL Dev. Cell 23 (6), 1247-1254 (2012)
PUBMED 23201121
REMARK GeneRIF: study reports that the V domain of ALIX binds directly and
selectively to K63-linked polyubiquitin chains, exhibiting a strong
preference for chains composed of more than three ubiquitins
REFERENCE 2 (bases 1 to 1569)
AUTHORS Lee,C.P., Liu,P.T., Kung,H.N., Su,M.T., Chua,H.H., Chang,Y.H.,
Chang,C.W., Tsai,C.H., Liu,F.T. and Chen,M.R.
TITLE The ESCRT machinery is recruited by the viral BFRF1 protein to the
nucleus-associated membrane for the maturation of Epstein-Barr
Virus
JOURNAL PLoS Pathog. 8 (9), E1002904 (2012)
PUBMED 22969426
REMARK GeneRIF: BFRF1 recruits the ESCRT components to modulate nuclear
envelope for the nuclear egress of Epstein Barr virus.
REFERENCE 3 (bases 1 to 1569)
AUTHORS Dores,M.R., Paing,M.M., Lin,H., Montagne,W.A., Marchese,A. and
Trejo,J.
TITLE AP-3 regulates PAR1 ubiquitin-independent MVB/lysosomal sorting via
an ALIX-mediated pathway
JOURNAL Mol. Biol. Cell 23 (18), 3612-3623 (2012)
PUBMED 22833563
REMARK GeneRIF: Data indicate that AP-3 facilitates PAR1 interaction with
ALIX.
REFERENCE 4 (bases 1 to 1569)
AUTHORS Mondal,G., Rowley,M., Guidugli,L., Wu,J., Pankratz,V.S. and
Couch,F.J.
TITLE BRCA2 localization to the midbody by filamin A regulates cep55
signaling and completion of cytokinesis
JOURNAL Dev. Cell 23 (1), 137-152 (2012)
PUBMED 22771033
REMARK GeneRIF: At the midbody, BRCA2 influences the recruitment of
endosomal sorting complex required for transport (ESCRT)-associated
proteins, Alix and Tsg101, and formation of CEP55-Alix and
CEP55-Tsg101 complexes during abscission.
REFERENCE 5 (bases 1 to 1569)
AUTHORS Maki,M., Suzuki,H. and Shibata,H.
TITLE Structure and function of ALG-2, a penta-EF-hand calcium-dependent
adaptor protein
JOURNAL Sci China Life Sci 54 (8), 770-779 (2011)
PUBMED 21786200
REMARK Review article
REFERENCE 6 (bases 1 to 1569)
AUTHORS Chatellard-Causse,C., Blot,B., Cristina,N., Torch,S., Missotten,M.
and Sadoul,R.
TITLE Alix (ALG-2-interacting protein X), a protein involved in
apoptosis, binds to endophilins and induces cytoplasmic
vacuolization
JOURNAL J. Biol. Chem. 277 (32), 29108-29115 (2002)
PUBMED 12034747
REFERENCE 7 (bases 1 to 1569)
AUTHORS Wu,Y., Pan,S., Che,S., He,G., Nelman-Gonzalez,M., Weil,M.M. and
Kuang,J.
TITLE Overexpression of Hp95 induces G1 phase arrest in confluent HeLa
cells
JOURNAL Differentiation 67 (4-5), 139-153 (2001)
PUBMED 11683497
REFERENCE 8 (bases 1 to 1569)
AUTHORS Missotten,M., Nichols,A., Rieger,K. and Sadoul,R.
TITLE Alix, a novel mouse protein undergoing calcium-dependent
interaction with the apoptosis-linked-gene 2 (ALG-2) protein
JOURNAL Cell Death Differ. 6 (2), 124-129 (1999)
PUBMED 10200558
REFERENCE 9 (bases 1 to 1569)
AUTHORS Vito,P., Pellegrini,L., Guiet,C. and D'Adamio,L.
TITLE Cloning of AIP1, a novel protein that associates with the
apoptosis-linked gene ALG-2 in a Ca2+-dependent reaction
JOURNAL J. Biol. Chem. 274 (3), 1533-1540 (1999)
PUBMED 9880530
REFERENCE 10 (bases 1 to 1569)
AUTHORS Robertson,N.G., Khetarpal,U., Gutierrez-Espeleta,G.A., Bieber,F.R.
and Morton,C.C.
TITLE Isolation of novel and known genes from a human fetal cochlear cDNA
library using subtractive hybridization and differential screening
JOURNAL Genomics 23 (1), 42-50 (1994)
PUBMED 7829101
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA652213.1, GQ131806.1 and
AI346371.1.
On Jan 11, 2012 this sequence version replaced gi:241982791.
Summary: This gene encodes a protein that functions within the
ESCRT pathway in the abscission stage of cytokinesis, in
intralumenal endosomal vesicle formation, and in enveloped virus
budding. Studies using mouse cells have shown that overexpression
of this protein can block apoptosis. In addition, the product of
this gene binds to the product of the PDCD6 gene, a protein
required for apoptosis, in a calcium-dependent manner. This gene
product also binds to endophilins, proteins that regulate membrane
shape during endocytosis. Overexpression of this gene product and
endophilins results in cytoplasmic vacuolization, which may be
partly responsible for the protection against cell death. Several
alternatively spliced transcript variants encoding different
isoforms have been found for this gene. Related pseudogenes have
been identified on chromosome 15. [provided by RefSeq, Jan 2012].
Transcript Variant: This variant (4) lacks several 3' exons but
contains an alternate 3' exon, and it thus differs in the 3' coding
region and 3' UTR, compared to variant 2. The encoded isoform (3)
has a distinct and significantly shorter C-terminus, compared to
isoform 2.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: GQ131806.1, BQ892829.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-74 DA652213.1 1-74
75-1209 GQ131806.1 1-1135
1210-1569 AI346371.1 1-360 c
FEATURES Location/Qualifiers
source 1..1569
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="3"
/map="3p22.3"
gene 1..1569
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/note="programmed cell death 6 interacting protein"
/db_xref="GeneID:10015"
/db_xref="HGNC:8766"
/db_xref="MIM:608074"
exon 1..367
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/inference="alignment:Splign:1.39.8"
variation 37
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:28381976"
variation 52
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:1141054"
variation 65..66
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace=""
/replace="tccgccag"
/db_xref="dbSNP:372627622"
variation 80
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="c"
/db_xref="dbSNP:368948546"
variation 90
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:189555154"
variation 134
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:371387868"
variation 151
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="c"
/db_xref="dbSNP:376758894"
CDS 159..974
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/note="isoform 3 is encoded by transcript variant 4; ALG-2
interacting protein 1; dopamine receptor interacting
protein 4; apoptosis-linked gene 2-interacting protein X;
PDCD6-interacting protein; ALG-2-interacting protein X"
/codon_start=1
/product="programmed cell death 6-interacting protein
isoform 3"
/protein_id="NP_001243121.1"
/db_xref="GI:371875427"
/db_xref="GeneID:10015"
/db_xref="HGNC:8766"
/db_xref="MIM:608074"
/translation="
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKVSYCFYKHLLTLHVKYLDFFVYKKQVETYKEI
"
misc_feature 162..>875
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/note="Protein-interacting Bro1-like domain of mammalian
Alix and related domains; Region: BRO1_Alix_like; cl14649"
/db_xref="CDD:187403"
misc_feature 168..>920
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/note="BRO1-like domain; Region: BRO1; smart01041"
/db_xref="CDD:198109"
misc_feature order(549..551,558..560,597..599,606..611,753..755,
762..767,792..794,801..806)
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/note="putative ESCRT-III binding site; other site"
/db_xref="CDD:185761"
variation 172
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:200697599"
variation 177
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:11554560"
variation 198
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="g"
/db_xref="dbSNP:199826661"
variation 236
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:140757943"
variation 237
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="g"
/db_xref="dbSNP:371329482"
variation 273
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:373978156"
variation 281
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="c"
/db_xref="dbSNP:368086022"
variation 294
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="g"
/db_xref="dbSNP:370244363"
variation 303
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:374913087"
variation 328
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:368462021"
variation 341
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="c"
/db_xref="dbSNP:182203537"
variation 351
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="c"
/db_xref="dbSNP:374644579"
exon 368..422
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/inference="alignment:Splign:1.39.8"
variation 401
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:138503843"
variation 405
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:145549670"
variation 414
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:201762719"
exon 423..492
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/inference="alignment:Splign:1.39.8"
variation 428
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:370717543"
variation 455
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:149504311"
variation 482
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:148116117"
exon 493..620
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/inference="alignment:Splign:1.39.8"
variation 495
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:371038293"
variation 508
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="g"
/replace="t"
/db_xref="dbSNP:374162851"
variation 602
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:112654570"
variation 603
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="g"
/replace="t"
/db_xref="dbSNP:368375025"
exon 621..774
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/inference="alignment:Splign:1.39.8"
variation 655
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:202035864"
variation 656
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:369522029"
variation 673
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:144962999"
variation 686
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:150039307"
variation 723
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="g"
/db_xref="dbSNP:145300590"
exon 775..1559
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/inference="alignment:Splign:1.39.8"
variation 831
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:112770546"
variation 837
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:143264432"
variation 865
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:368925669"
variation 884
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:370773607"
variation 907
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:189083325"
variation 910
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="g"
/replace="t"
/db_xref="dbSNP:111356602"
variation 969
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:113593059"
variation 971
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:368958416"
variation 1013..1014
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace=""
/replace="t"
/db_xref="dbSNP:5847793"
variation 1014..1015
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace=""
/replace="t"
/db_xref="dbSNP:35254856"
variation 1015
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="t"
/db_xref="dbSNP:80148260"
variation 1026..1028
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace=""
/replace="ttt"
/db_xref="dbSNP:80061840"
variation 1091
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:74965802"
variation 1104
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="c"
/replace="t"
/db_xref="dbSNP:150347086"
variation 1178..1179
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace=""
/replace="tc"
/db_xref="dbSNP:139661014"
variation 1212
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:62252774"
variation 1235
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="g"
/db_xref="dbSNP:374437912"
variation 1280
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="a"
/replace="c"
/db_xref="dbSNP:200371377"
variation 1446
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
/replace="g"
/replace="t"
/db_xref="dbSNP:142669304"
polyA_signal 1537..1542
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
polyA_site 1559
/gene="PDCD6IP"
/gene_synonym="AIP1; ALIX; DRIP4; HP95"
ORIGIN
gctggagctcccggaagttgccggacccggaacgcaggcggagcgcaagtctgtcagccagtcagtccgccagtccgccagcccagtacctctctctcctcggccctcgtaagctgtccgcggtctgtttggcccgaacggcggcggaggcgctgatcatggcgacattcatctcggtgcagctgaaaaagacctcagaggtggacctggccaagccgctggtgaagttcatccagcagacttacccaagcggcggggaagagcaggcccagtactgccgcgcggcggaggagctcagcaagctgcgccgcgccgcagtcggtcgtccgctggacaagcacgagggcgcgctcgagacgctcctgagatattatgatcagatttgttctattgaacccaaattcccattttctgaaaatcagatctgcttgacatttacctggaaggatgctttcgataaaggttcactttttggaggctctgtaaaactggctcttgcaagcttaggatatgaaaagagctgtgtgttgttcaattgtgcagccttagctagccaaattgcagcagaacagaacctggataatgatgaaggattgaaaatcgctgctaaacattaccagtttgctagtggtgcctttttacatattaaagagacggttttatctgccttaagtcgagagccgaccgtggacatatctccagatactgttgggaccctcagtcttattatgctggcacaggctcaagaagtattttttttaaaagccacaagagataaaatgaaagatgccatcatagctaaattggctaatcaggctgcagattattttggtgatgctttcaaacagtgtcaatacaaagatactctccccaaggtcagttattgtttttataaacacttgcttactttgcatgtgaaatatttagacttttttgtgtataagaagcaagttgaaacttataaagaaatttgaagttttaatagagttatctgaagtatatagtagaaatagtttttttttttttttaatttaagatgcatgaacaattcttttatgtttaggggatgcctttgtctttaccttttactaaacttgtttttccaagctagaactctttctggaaaatgttgaccatctgttttcaatacttttatcaaatcaaggcattgtgtagttctgaatcattggtgatttggtacaagcatgtatacttgagcatgttgatgattcacacttttaattattgtcctgttttcttaaagatgagccttaaagcgcaaaaacagacataaagaaaaaaggaaaagaaaacttaacaaattcatctgatactttgattagaattcagttttgccaacagggataaaaaattgggctgctaatggacagctaaggaaagcaaccatcttaaaccacatatcacaggaagtataatgttttaatgtaaacctttctgaagtgacaattgtaaagactattcagtgatgatcatttgttaatgacaaagcaaatcactagtaaatttggaatgattaataaagaaaacttaaagattgaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10015 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10015 -> Molecular function: GO:0017124 [SH3 domain binding] evidence: IEA
GeneID:10015 -> Molecular function: GO:0046983 [protein dimerization activity] evidence: IEA
GeneID:10015 -> Molecular function: GO:0048306 [calcium-dependent protein binding] evidence: IPI
GeneID:10015 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10015 -> Biological process: GO:0007049 [cell cycle] evidence: IEA
GeneID:10015 -> Biological process: GO:0015031 [protein transport] evidence: IEA
GeneID:10015 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:10015 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:10015 -> Biological process: GO:0019067 [viral assembly, maturation, egress, and release] evidence: TAS
GeneID:10015 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:10015 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10015 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA
GeneID:10015 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10015 -> Cellular component: GO:0042470 [melanosome] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.