GGRNA Home | Help | Advanced search

2025-07-04 12:21:14, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001253790            1032 bp    mRNA    linear   PRI 25-JUN-2013
DEFINITION  Homo sapiens small integral membrane protein 22 (SMIM22),
            transcript variant 1, mRNA.
ACCESSION   NM_001253790 NR_029453 XM_001722191 XM_002343413 XM_002343414
            XM_002344947 XM_002344948 XM_002347585 XM_002347586 XM_935391
            XM_945742
VERSION     NM_001253790.1  GI:359385720
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1032)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC035868.1 and CK903133.1.
            On Dec 6, 2011 this sequence version replaced gi:262073050.
            
            Transcript Variant: This variant (1) represents the longest
            transcript and encodes isoform (1). Both variants 1 and 3 encode
            the same isoform (1).
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC035868.1, AA675917.1 [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-822               BC035868.1         1-822
            823-1032            CK903133.1         320-529
FEATURES             Location/Qualifiers
     source          1..1032
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16p13.3"
     gene            1..1032
                     /gene="SMIM22"
                     /note="small integral membrane protein 22"
                     /db_xref="GeneID:440335"
                     /db_xref="HGNC:48329"
     exon            1..375
                     /gene="SMIM22"
                     /inference="alignment:Splign:1.39.8"
     variation       68
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181863512"
     variation       98
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759992"
     variation       113
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138720230"
     variation       220
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3747608"
     variation       224
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186426582"
     variation       288
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190181867"
     variation       293
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181844875"
     variation       324
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79151406"
     exon            376..500
                     /gene="SMIM22"
                     /inference="alignment:Splign:1.39.8"
     variation       383
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74829349"
     STS             408..827
                     /gene="SMIM22"
                     /db_xref="UniSTS:486182"
     variation       420
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183293353"
     variation       426
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187592886"
     misc_feature    431..433
                     /gene="SMIM22"
                     /note="upstream in-frame stop codon"
     exon            501..644
                     /gene="SMIM22"
                     /inference="alignment:Splign:1.39.8"
     CDS             521..772
                     /gene="SMIM22"
                     /note="isoform 1 is encoded by transcript variant 1"
                     /codon_start=1
                     /product="uncharacterized protein LOC440335 isoform 1"
                     /protein_id="NP_001240719.1"
                     /db_xref="GI:359385721"
                     /db_xref="CCDS:CCDS59258.1"
                     /db_xref="GeneID:440335"
                     /db_xref="HGNC:48329"
                     /translation="
MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRKERPKGVDNLALEP
"
     variation       590
                     /gene="SMIM22"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:73513279"
     variation       624
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:118018626"
     exon            645..730
                     /gene="SMIM22"
                     /inference="alignment:Splign:1.39.8"
     variation       649
                     /gene="SMIM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377225414"
     variation       674
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192561106"
     exon            731..1032
                     /gene="SMIM22"
                     /inference="alignment:Splign:1.39.8"
     variation       787
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375411283"
     variation       812
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184373341"
     variation       836
                     /gene="SMIM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:189079794"
     variation       866
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181264433"
     variation       868
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185044021"
     variation       876
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62036088"
     variation       878
                     /gene="SMIM22"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189109189"
     variation       936
                     /gene="SMIM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141585095"
     variation       965
                     /gene="SMIM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150874528"
     variation       984
                     /gene="SMIM22"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139374328"
     variation       985
                     /gene="SMIM22"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373556979"
     variation       1017
                     /gene="SMIM22"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145436548"
ORIGIN      
gcacttgctgtgacccccacctggaggcttctctgcagcaggagcaggagctgttacccttctaatccccacaatgaccccagcctaataatacaataatccccaagtagaaccaggggcccaaggccccctcgtcagctgggctcccacctccaagctgacgccctcaaccactctgctggggtgagcaaacccaggccccacagctggctagcgggatatccgtgtccacgattggcgccatgtgttttaagttgcagcgtcaaaaacatgaagagattgctttagcaaatatttacccagtcctgactctgcacatggcatcgttctaggagcccaaagatgttaacttgtttaataatcaagccctgtgaaggagtttatagcatctgtggattttggtacccacggaggtgctggaaccaatcgttgaggattccaaggacaactctatgatgcaggcacacctgtcctagctgctcaagggtcgtgggatgcaggtggcacggtgcacgccaagatggctgtgtccacagaggagctggaggccacggttcaggaagtcctggggagactgaagagccaccagtttttccagtccacatgggacactgttgccttcattgttttcctcaccttcatgggcaccgtgctgctcctgctgctgctggtcgtcgcccactgctgctgctgcagctcccccgggccccgcagggaaagccccaggaaggaaagacccaagggagtggataacttggccctggaaccctgaccctgtgtctcctgcccggtggcagtaacaaagccttctgtctgcccagagcctgagtctgcagtgtcttccagtccccgtctgggtgggtgacgcgggactcgccgccccactcaggtggccacctggcctctccaagccttcagtcagcacgactgtgccaggtcatcctcagtcacctagctgggaggggagctggtctcaggccgggcgcggtggctcacacctataatcccagcactttgggaggccgaggtggg
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.