GGRNA Home | Help | Advanced search

2024-04-20 10:30:16, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001252197            2075 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens iroquois homeobox 5 (IRX5), transcript variant 2,
            mRNA.
ACCESSION   NM_001252197
VERSION     NM_001252197.1  GI:356582256
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2075)
  AUTHORS   Bonnard,C., Strobl,A.C., Shboul,M., Lee,H., Merriman,B.,
            Nelson,S.F., Ababneh,O.H., Uz,E., Guran,T., Kayserili,H., Hamamy,H.
            and Reversade,B.
  TITLE     Mutations in IRX5 impair craniofacial development and germ cell
            migration via SDF1
  JOURNAL   Nat. Genet. 44 (6), 709-713 (2012)
   PUBMED   22581230
  REMARK    GeneRIF: Our findings suggest that IRX proteins integrate
            combinatorial transcriptional inputs to regulate key signaling
            molecules involved in the ontogeny of multiple organs during
            embryogenesis and homeostasis.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2075)
  AUTHORS   Murea,M., Lu,L., Ma,L., Hicks,P.J., Divers,J., McDonough,C.W.,
            Langefeld,C.D., Bowden,D.W. and Freedman,B.I.
  TITLE     Genome-wide association scan for survival on dialysis in
            African-Americans with type 2 diabetes
  JOURNAL   Am. J. Nephrol. 33 (6), 502-509 (2011)
   PUBMED   21546767
REFERENCE   3  (bases 1 to 2075)
  AUTHORS   Myrthue,A., Rademacher,B.L., Pittsenbarger,J., Kutyba-Brooks,B.,
            Gantner,M., Qian,D.Z. and Beer,T.M.
  TITLE     The iroquois homeobox gene 5 is regulated by 1,25-dihydroxyvitamin
            D3 in human prostate cancer and regulates apoptosis and the cell
            cycle in LNCaP prostate cancer cells
  JOURNAL   Clin. Cancer Res. 14 (11), 3562-3570 (2008)
   PUBMED   18519790
  REMARK    GeneRIF: Irx5 is involved in the regulation of both the cell cycle
            and apoptosis in human prostate cancer cells
REFERENCE   4  (bases 1 to 2075)
  AUTHORS   Bruneau,B.G.
  TITLE     [Irx5: a transcription factor that regulates the cardiac
            repolarization gradient]
  JOURNAL   Med Sci (Paris) 22 (3), 231-232 (2006)
   PUBMED   16527195
  REMARK    GeneRIF: involved in transcriptional regulation of heart
            morphogenesis
REFERENCE   5  (bases 1 to 2075)
  AUTHORS   Ogura,K., Matsumoto,K., Kuroiwa,A., Isobe,T., Otoguro,T.,
            Jurecic,V., Baldini,A., Matsuda,Y. and Ogura,T.
  TITLE     Cloning and chromosome mapping of human and chicken Iroquois (IRX)
            genes
  JOURNAL   Cytogenet. Cell Genet. 92 (3-4), 320-325 (2001)
   PUBMED   11435706
REFERENCE   6  (bases 1 to 2075)
  AUTHORS   Lewis,M.T., Ross,S., Strickland,P.A., Snyder,C.J. and Daniel,C.W.
  TITLE     Regulated expression patterns of IRX-2, an Iroquois-class homeobox
            gene, in the human breast
  JOURNAL   Cell Tissue Res. 296 (3), 549-554 (1999)
   PUBMED   10370142
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY335945.1.
            
            Summary: This gene encodes a member of the iroquois homeobox gene
            family, which are involved in several embryonic developmental
            processes. Knockout mice lacking this gene show that it is required
            for retinal cone bipolar cell differentiation, and that it
            negatively regulates potassium channel gene expression in the heart
            to ensure coordinated cardiac repolarization. Alternatively spliced
            transcript variants encoding different isoforms have been found for
            this gene. [provided by RefSeq, Nov 2011].
            
            Transcript Variant: This variant (2) uses an alternate, in-frame
            acceptor splice site at the 3' terminal exon compared to variant 1.
            This results in an isoform (2) that is 1 aa shorter than isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY335945.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025083, ERS025087 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-2075              AY335945.1         1-2075
FEATURES             Location/Qualifiers
     source          1..2075
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16q12.2"
     gene            1..2075
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="iroquois homeobox 5"
                     /db_xref="GeneID:10265"
                     /db_xref="HGNC:14361"
                     /db_xref="MIM:606195"
     STS             1..1536
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /db_xref="UniSTS:486427"
     CDS             1..1449
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="isoform 2 is encoded by transcript variant 2;
                     iroquois-class homeodomain protein IRX-5; homeodomain
                     protein IRXB2; homeodomain protein IRX-2A"
                     /codon_start=1
                     /product="iroquois-class homeodomain protein IRX-5 isoform
                     2"
                     /protein_id="NP_001239126.1"
                     /db_xref="GI:356582257"
                     /db_xref="CCDS:CCDS58462.1"
                     /db_xref="GeneID:10265"
                     /db_xref="HGNC:14361"
                     /db_xref="MIM:606195"
                     /translation="
MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPGYNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTPRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPEAGAEQKAASGCERLQGPPTPAGKETEGSLSDSDFKEPPSEGRLDALQGPPRTGGPSPAGPAAARLAEDPAPHYPAGAPAPGPHPAAGEVPPGPGGPSVIHSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGNEGSPCPPCPGPIAGQALGGSRASPAPAPSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNYGSFGHLHGHPGPGPGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPYELKKGMSDI
"
     misc_feature    349..525
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(349..354,358..360,418..420,436..438,475..477,
                     481..486,493..498,502..510,514..519)
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(355..357,484..486,493..498,505..507)
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     exon            1..249
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /inference="alignment:Splign:1.39.8"
     variation       25
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:13336969"
     variation       61
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373958797"
     variation       100
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377035980"
     variation       128
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200623174"
     exon            250..655
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /inference="alignment:Splign:1.39.8"
     variation       258
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367957249"
     variation       324
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374150005"
     variation       357
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151037166"
     variation       375
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377509714"
     STS             396..460
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /standard_name="Irx3"
                     /db_xref="UniSTS:498475"
     variation       402
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141819678"
     variation       448
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:387907198"
     variation       471
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201130194"
     variation       510
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370696419"
     variation       567
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150223604"
     variation       646
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373164018"
     exon            656..2061
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /inference="alignment:Splign:1.39.8"
     variation       678
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139113918"
     variation       686
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377050650"
     variation       688
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200111411"
     variation       704
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115549200"
     variation       710
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374666773"
     variation       713
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199865474"
     variation       714
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369095091"
     variation       760
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:13336114"
     variation       775
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199861709"
     variation       873
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7188328"
     variation       1089
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375662858"
     variation       1098
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201738191"
     variation       1113
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370016055"
     variation       1132
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201360101"
     variation       1138
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377649301"
     variation       1142
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202086902"
     variation       1153
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375313978"
     variation       1161
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377595777"
     variation       1180
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370331090"
     variation       1229
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200394212"
     variation       1251
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373826345"
     variation       1262
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143660069"
     variation       1289
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368818152"
     variation       1378
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201200647"
     variation       1391
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147189488"
     variation       1418
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200920393"
     variation       1462
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202087837"
     variation       1479
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:181048280"
     variation       1522..1525
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace=""
                     /replace="gaga"
                     /db_xref="dbSNP:375453518"
     variation       1574
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183727841"
     variation       1614
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189712212"
     variation       1620
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375093347"
     variation       1621
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:7190373"
     variation       1622..1624
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="aaa"
                     /replace="cac"
                     /db_xref="dbSNP:367688412"
     variation       1622
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113225061"
     variation       1623
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1133610"
     variation       1638
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371830279"
     variation       1679
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141076276"
     variation       1701..1705
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace=""
                     /replace="gcatt"
                     /db_xref="dbSNP:71865827"
     variation       1804
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374076585"
     variation       1836
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:181183549"
     variation       1903
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1133611"
     variation       1992
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186840955"
     polyA_signal    2034..2039
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
     variation       2058
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:192716743"
     polyA_site      2061
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
ORIGIN      

atgtcctatccgcagggctacttgtaccagccgtccgcctcgctggcgctctactcgtgcccggcgtacagcaccagcgtcatttcggggccccgcacggatgagctcggccgctcttcttcgggctccgcgttctcgccctacgctggctcgactgccttcacggcgccctcgccgggctacaactcgcacctccagtacggcgccgaccccgcggccgccgccgccgccgccttctcctcgtacgtgggctctccctacgaccacacacccggcatggcgggctccttggggtaccatccttacgcggcgcccctgggatcgtacccttacggggacccagcgtaccggaagaacgccacaagggacgccacggctaccctcaaggcctggctcaacgagcaccgcaagaacccctaccccaccaagggcgagaagatcatgctggccatcatcaccaagatgaccctcacccaggtgtccacctggttcgccaacgcgcgccggcgcctcaagaaagagaataaaatgacgtggacgccgcggaaccgcagcgaggacgaggaagaggaggagaacattgacctggagaagaacgacgaggacgagccccagaagcccgaggacaagggcgaccccgagggccccgaagcaggagctgagcagaaggcggcttcgggctgcgaacggcttcagggaccacccacccctgcaggcaaggagacggagggcagcctcagcgactcggattttaaggagccgccctcggagggccgcctcgacgcgctgcagggccccccccgcaccggcgggccctccccggctgggccagcggcggcgcggctggcggaggacccggcccctcactaccccgccggagcgccggcgcccggcccgcatccagccgcgggcgaggtgcctccgggtcccggcgggccctcggttatccattcgccgcctccgccgccgcctcctgcggtgctcgccaagcccaaactgtggtctttggcagagatcgccacatcgtcggacaaggtcaaggacgggggcggcgggaacgagggctctccatgcccaccgtgtcccgggcccatagccgggcaagccctaggaggcagccgggcgtcgccggccccggcgccgtcacgctcgccctcggcgcagtgtccttttccaggcgggacggtgctgtcccggcctctctactacaccgcgcccttctatcccggctacacgaactatggctccttcggacaccttcatggccacccggggcccgggccaggccccacaaccggtccggggtctcatttcaatggattaaaccagaccgtgttgaaccgagcggacgctttggctaaagacccgaaaatgttgcggagccagtctcagctagacctgtgcaaagactctccctatgaattgaagaaaggtatgtccgacatttaacgcgggctgcgtcggtcccggacttttctaatttattaaaaacatggccttggcagttatttttccatcaccgagagagagagacagagagagaaaataaactacccctcctattcagaagtttatagtttatggagatggatgacataaaaatgtaaacatctccacacaaaaaaaaaaatgtcttaaccaaccgaaaagaaaaattaaaaaaggatttgtattaaatcttattctgtatatttaatgtagcatttttgtatttaaattgataattcaatatctttgaagtaaattatgaaatcaagacacctgtacaggcatttaatgtttttttgtaatataaatatatacatttgtgtttcccccaaaactgtttcatagttaaaaaatacaagtttaatttaattttttacacctattgattctgctgggtatgagctaaagtattacagaaaggaaacaggttatactcttagatttaaaaagtgaaagaaactgcaggcgcctttgtaaaatgcaaaatatttaattaaaagagattttaacataatgagagccactcattactttttagaagcctcaataaactgtccattgccttggtcaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:10265 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:10265 -> Molecular function: GO:0005499 [vitamin D binding] evidence: IEA
            GeneID:10265 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:10265 -> Biological process: GO:0002027 [regulation of heart rate] evidence: IEA
            GeneID:10265 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:10265 -> Biological process: GO:0007601 [visual perception] evidence: IEA
            GeneID:10265 -> Biological process: GO:0008406 [gonad development] evidence: IMP
            GeneID:10265 -> Biological process: GO:0042551 [neuron maturation] evidence: IEA
            GeneID:10265 -> Biological process: GO:0048701 [embryonic cranial skeleton morphogenesis] evidence: IMP
            GeneID:10265 -> Biological process: GO:0050896 [response to stimulus] evidence: IEA
            GeneID:10265 -> Biological process: GO:0060040 [retinal bipolar neuron differentiation] evidence: IEA
            GeneID:10265 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.