GGRNA Home | Help | Advanced search

2020-10-24 05:51:21, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001244676            2169 bp    mRNA    linear   PRI 20-APR-2013
DEFINITION  Homo sapiens threonine synthase-like 2 (S. cerevisiae) (THNSL2),
            transcript variant 2, mRNA.
ACCESSION   NM_001244676
VERSION     NM_001244676.1  GI:347658948
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2169)
  AUTHORS   Fox,C.S., Liu,Y., White,C.C., Feitosa,M., Smith,A.V.,
            Heard-Costa,N., Lohman,K., Johnson,A.D., Foster,M.C.,
            Greenawalt,D.M., Griffin,P., Ding,J., Newman,A.B., Tylavsky,F.,
            Miljkovic,I., Kritchevsky,S.B., Launer,L., Garcia,M.,
            Eiriksdottir,G., Carr,J.J., Gudnason,V., Harris,T.B., Cupples,L.A.
            and Borecki,I.B.
  CONSRTM   GIANT Consortium; MAGIC Consortium; GLGC Consortium
  TITLE     Genome-wide association for abdominal subcutaneous and visceral
            adipose reveals a novel locus for visceral fat in women
  JOURNAL   PLoS Genet. 8 (5), E1002695 (2012)
   PUBMED   22589738
REFERENCE   2  (bases 1 to 2169)
  AUTHORS   Mason,C.C., Hanson,R.L., Ossowski,V., Bian,L., Baier,L.J.,
            Krakoff,J. and Bogardus,C.
  TITLE     Bimodal distribution of RNA expression levels in human skeletal
            muscle tissue
  JOURNAL   BMC Genomics 12, 98 (2011)
   PUBMED   21299892
  REMARK    GeneRIF: THNSL2 was found to have bimodal expression in human
            skeletal muscle tissue.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2169)
  AUTHORS   Rifas,L. and Weitzmann,M.N.
  TITLE     A novel T cell cytokine, secreted osteoclastogenic factor of
            activated T cells, induces osteoclast formation in a
            RANKL-independent manner
  JOURNAL   Arthritis Rheum. 60 (11), 3324-3335 (2009)
   PUBMED   19877052
  REMARK    GeneRIF: A cytokine named SOFAT (secreted osteoclastogenic factor
            of activated T cells) can induce osteoblastic IL-6 production and
            osteoclast formation in the absence of osteoblasts or RANKL. It is
            insensitive to RANKL inhibitor osteoprotegerin.
REFERENCE   4  (bases 1 to 2169)
  AUTHORS   Donini,S., Percudani,R., Credali,A., Montanini,B., Sartori,A. and
            Peracchi,A.
  TITLE     A threonine synthase homolog from a mammalian genome
  JOURNAL   Biochem. Biophys. Res. Commun. 350 (4), 922-928 (2006)
   PUBMED   17034760
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BI765911.1, AC092836.4,
            BC064423.1 and AI313402.1.
            This sequence is a reference standard in the RefSeqGene project.
            
            Summary: This gene encodes a threonine synthase-like protein. A
            similar enzyme in mouse can catalyze the degradation of
            O-phospho-homoserine to a-ketobutyrate, phosphate, and ammonia.
            This protein also has phospho-lyase activity on both gamma and beta
            phosphorylated substrates. In mouse an alternatively spliced form
            of this protein has been shown to act as a cytokine and can induce
            the production of the inflammatory cytokine IL6 in osteoblasts.
            Alternate splicing results in multiple transcript variants.
            [provided by RefSeq, Sep 2011].
            
            Transcript Variant: This variant (2) has a longer 5' UTR and uses
            an alternate exon in the 3' coding region, which results in a
            frameshift, compared to variant 1. The resulting protein (isoform
            2) has a distinct C-terminus, compared to isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC064423.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-19                BI765911.1         5-23
            20-103              AC092836.4         103499-103582
            104-295             BC064423.1         1-192
            296-296             AC092836.4         106457-106457
            297-1143            BC064423.1         194-1040
            1144-1144           AC092836.4         116151-116151
            1145-1981           BC064423.1         1042-1878
            1982-2152           BC064423.1         1880-2050
            2153-2169           AI313402.1         1-17                c
FEATURES             Location/Qualifiers
     source          1..2169
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p11.2"
     gene            1..2169
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="threonine synthase-like 2 (S. cerevisiae)"
                     /db_xref="GeneID:55258"
                     /db_xref="HGNC:25602"
                     /db_xref="MIM:611261"
     exon            1..162
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       21
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188854408"
     variation       50
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6547758"
     variation       78
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:116594156"
     variation       121..127
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace=""
                     /replace="cgcgccc"
                     /db_xref="dbSNP:72312334"
     variation       145..158
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace=""
                     /replace="gccccgcgccccgc"
                     /db_xref="dbSNP:56213803"
     variation       152..158
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace=""
                     /replace="gccccgc"
                     /db_xref="dbSNP:61547350"
     exon            163..397
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     CDS             175..1392
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /EC_number="4.2.3.-"
                     /note="isoform 2 is encoded by transcript variant 2;
                     secreted osteoclastogenic factor of activated T cells"
                     /codon_start=1
                     /product="threonine synthase-like 2 isoform 2"
                     /protein_id="NP_001231605.1"
                     /db_xref="GI:347658949"
                     /db_xref="CCDS:CCDS58718.1"
                     /db_xref="GeneID:55258"
                     /db_xref="HGNC:25602"
                     /db_xref="MIM:611261"
                     /translation="
MWYVSTRGVAPRVNFEGALFSGYAPDGGLFMPEELPQLDRGTLCQWSTLSYPGLVKELCALFIGSELLPKDELNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCTTQFLQYFLEKREKHVTVVVGTSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKWERQDYEKMAVMECDGCCVELCLGNCGPRRGSVTDIPGTAMVRGGG
"
     misc_feature    175..1251
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="Threonine synthase [Amino acid transport and
                     metabolism]; Region: ThrC; COG0498"
                     /db_xref="CDD:30844"
     misc_feature    178..>1251
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="Threonine synthase catalyzes the final step of
                     threonine biosynthesis. The conversion of
                     O-phosphohomoserine into threonine and inorganic phosphate
                     is pyridoxal 5'-phosphate dependent. The Thr-synth_1 CD
                     includes members from higher plants, cyanobacteria;
                     Region: Thr-synth_2; cd01560"
                     /db_xref="CDD:107203"
     misc_feature    order(511..513,955..960)
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107203"
     misc_feature    511..513
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107203"
     variation       198
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367785526"
     variation       206
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374311669"
     variation       209
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139953850"
     variation       239
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369820777"
     variation       242
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151033743"
     variation       251
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373551702"
     variation       252
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114858196"
     variation       296
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4129190"
     variation       303
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370944153"
     variation       305
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146704484"
     variation       314
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143468353"
     variation       316
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142011143"
     variation       337
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147509382"
     variation       388
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199500112"
     exon            398..592
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       405
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371211298"
     variation       406
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34841493"
     variation       410
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376146285"
     variation       413
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142704703"
     variation       428
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376220295"
     variation       454
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143431033"
     variation       477
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199609866"
     variation       493
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145369179"
     variation       496
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35541720"
     variation       513
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149024211"
     variation       535
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143018511"
     variation       538
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143306537"
     variation       563
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111555319"
     variation       569
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:137996561"
     variation       576
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149479181"
     variation       577
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192084638"
     exon            593..745
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       603
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75522866"
     variation       643
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375276075"
     variation       656
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139757275"
     variation       697
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144678899"
     variation       706
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372908030"
     variation       712
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374885568"
     variation       713
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369239668"
     variation       730
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371602854"
     exon            746..976
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       768
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146726960"
     variation       785
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:34136143"
     variation       789
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150966723"
     variation       795
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116861191"
     variation       796
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369508046"
     variation       902
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34250376"
     variation       915
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149200089"
     variation       961
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370334316"
     variation       964
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141464891"
     exon            977..1125
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       988
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371763302"
     variation       993
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73949231"
     variation       1013
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375483620"
     variation       1017
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35051888"
     variation       1020
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148640386"
     variation       1021
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147776956"
     variation       1033
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368558816"
     variation       1044
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145009340"
     variation       1053
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200402354"
     variation       1070
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375964297"
     variation       1095
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141094872"
     exon            1126..1251
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       1132
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138871561"
     variation       1144
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17855905"
     variation       1145
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199612488"
     variation       1147
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376687469"
     variation       1155
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:36125522"
     variation       1186
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369834788"
     variation       1238
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374321239"
     exon            1252..1425
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       1266
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:116768700"
     variation       1269
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369418272"
     variation       1270
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188212837"
     variation       1277
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181348308"
     variation       1331
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76063088"
     variation       1336
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78406786"
     variation       1348
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76505901"
     exon            1426..2165
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       1448
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76963547"
     variation       1465
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377665314"
     variation       1511
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200685654"
     variation       1512
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375608550"
     variation       1525
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368148454"
     variation       1532
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200077966"
     variation       1534
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370502681"
     variation       1544
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143087335"
     variation       1560
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151161854"
     variation       1589
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367584313"
     variation       1590
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372281823"
     variation       1641
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141207786"
     variation       1651
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3210976"
     variation       1710
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78594831"
     variation       1717
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146940055"
     STS             1846..2150
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /standard_name="D2S2610"
                     /db_xref="UniSTS:37791"
     variation       1932
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3183983"
     variation       1977..1978
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:3215271"
     STS             2002..2136
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /standard_name="RH47580"
                     /db_xref="UniSTS:63546"
     variation       2008
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115884283"
     variation       2036
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127735"
     variation       2080
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127736"
     variation       2087
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1127738"
     polyA_signal    2133..2139
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
     polyA_site      2165
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
ORIGIN      
cactgcgaagctgagaaccctagctccggccccgaccggaagccccaccgcaccgtcagggacgcggactcgggagtgcgcacattcgcagcccgggcagccctgctgcgcaccgggcctcgcgccccgcgccccgcgccccgcgccccgcgccccgcaccggcctccaggatcatgtggtatgtcagcaccaggggcgtagccccacgggtcaactttgagggggccctcttctctggctatgcacctgacgggggcctctttatgcctgaagagctcccacagttggacagagggaccctgtgccagtggagcacactctcctatcctggcctggtgaaggagctgtgtgccctcttcattggctctgagctccttccaaaagatgaattaaatgatctgatcgaccgagccttcagcagattccgtcacagagaagtggtccatctgtccaggttgaggaatgggctgaacgtgttggagctgtggcatggcgtcacatatgcatttaaggacctgtccctgtcctgcacaacacagttcctgcagtacttcctggagaagagggagaagcacgtcactgtggttgtaggaacatctggggacacaggaagtgctgccattgagagtgttcaaggggcaaagaacatggacattatcgttctgctgcccaaaggtcactgcacaaagattcaggagctccagatgacaacggtgctgaagcagaacgtacatgtgtttggagtggagggaaacagcgatgagctcgatgagccgatcaagactgtgtttgccgatgtggcttttgtcaagaagcacaatctgatgagcctgaattcgatcaactggtcccgggtcctggtgcagatggcccatcacttctttgcttacttccagtgtacgccatccttggacacacatcccctacccctggtggaggtggttgtgccaacaggggctgccggtaaccttgcagctgggtacattgctcaaaagataggcctgcccatccgtctggtcgtggcagtgaaccgcaatgacatcatccacaggactgtccagcagggagacttctctctctctgaggctgttaaatcaaccttggcatcagctatggacattcaggtgccctacaacatggagagggtgttctggctgctctctggctctgacagccaggtgacaagagccctcatggagcagtttgaaaggacccaaagtgtgaatctgcccaaggaactgcacagcaagtgggagagacaggactacgaaaaaatggctgtaatggagtgtgatgggtgctgtgtggaactgtgccttggaaactgtgggcccagaagagggagcgtgacagatatcccagggacagccatggtcagaggtggtggctgagctggcctccaaccaggaggagcagtttgccagcactccccggtgctgcctcgcccctgcctctgcagccaagttcccggaagctgtcctggctgctggcctgacccctgagactcccgcggagatcgtagccctggagcacaaggagacacgctgcaccctgatgcggagaggtgacaactggatgctgatgcttcgggacaccattgaggaccttagccgacagtggaggagtcatgccctcaacacctcccagtagcctggctggaggtggctttctttaggcttcagatcccaggaagatgcaccttctgagctgccttgtgcaccctccccattaagcgtaggttaggaggtttccgggaggctgctcagctggatctggagccagctggctttgctccgttccctggctagtctgtgcctggtcaccagggaggctgagtgaggggctgtgaacagttgccggaagcaccccctccctccccggcccgtgcagcagtgtctgagctgtagtgaaagtttcagggcctgcaaaagaagaggcttgggcacaggactgaccatggctccaggggtttaggaccccagacctgtgaaggtgggagcagctcaccaccttcacgcaggctttgtatgttctctgagccttagttgattttggcccccaaaccaaatccaaaggttctggcccaccttgtcagaggcttccaccctgctcacatgttgggaatccctggaataaaatgcttgttcagtgtgatggagcggcaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:55258 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:55258 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA
            GeneID:55258 -> Molecular function: GO:0016829 [lyase activity] evidence: IEA
            GeneID:55258 -> Molecular function: GO:0030170 [pyridoxal phosphate binding] evidence: ISS
            GeneID:55258 -> Molecular function: GO:0070905 [serine binding] evidence: ISS
            GeneID:55258 -> Biological process: GO:0008150 [biological_process] evidence: ND
            GeneID:55258 -> Biological process: GO:0009071 [serine family amino acid catabolic process] evidence: ISS
            GeneID:55258 -> Biological process: GO:0016311 [dephosphorylation] evidence: ISS
            GeneID:55258 -> Biological process: GO:0046360 [2-oxobutyrate biosynthetic process] evidence: ISS
            GeneID:55258 -> Cellular component: GO:0005575 [cellular_component] evidence: ND
            GeneID:55258 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_001231605 -> EC 4.2.3.-

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.