2024-04-27 09:15:22, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001242915 1509 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens zinc finger, AN1-type domain 6 (ZFAND6), transcript variant 6, mRNA. ACCESSION NM_001242915 VERSION NM_001242915.1 GI:339276068 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1509) AUTHORS Chang,E.J., Ha,J., Kang,S.S., Lee,Z.H. and Kim,H.H. TITLE AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling JOURNAL Int. J. Biochem. Cell Biol. 43 (11), 1612-1620 (2011) PUBMED 21810480 REMARK GeneRIF: The AN1 domain of AWP1 mediated the functional interaction with tumor necrosis factor receptor-associated factor 2, and the A20 domain was responsible for the negative regulation of nuclear factor kappaB activation. REFERENCE 2 (bases 1 to 1509) AUTHORS de Miguel-Yanes,J.M., Shrader,P., Pencina,M.J., Fox,C.S., Manning,A.K., Grant,R.W., Dupuis,J., Florez,J.C., D'Agostino,R.B. Sr., Cupples,L.A. and Meigs,J.B. CONSRTM MAGIC Investigators; DIAGRAM+ Investigators TITLE Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms JOURNAL Diabetes Care 34 (1), 121-125 (2011) PUBMED 20889853 REMARK GeneRIF: Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator) REFERENCE 3 (bases 1 to 1509) AUTHORS Cao,Y.K., Mo,Y.Y., Tian,F.Z., Liu,Y.W., Deng,P., Qin,Q.H. and Jiang,Y. TITLE [Construction of GFP-AWP1 fusion gene vector and its expression in 293 cells] JOURNAL Di Yi Jun Yi Da Xue Xue Bao 25 (2), 174-176 (2005) PUBMED 15698998 REFERENCE 4 (bases 1 to 1509) AUTHORS Duan,W., Sun,B., Li,T.W., Tan,B.J., Lee,M.K. and Teo,T.S. TITLE Cloning and characterization of AWP1, a novel protein that associates with serine/threonine kinase PRK1 in vivo JOURNAL Gene 256 (1-2), 113-121 (2000) PUBMED 11054541 REFERENCE 5 (bases 1 to 1509) AUTHORS Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S. TITLE Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing JOURNAL EMBO Rep. 1 (3), 287-292 (2000) PUBMED 11256614 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA091136.1, AF261138.1 and AW571396.1. Transcript Variant: This variant (6) differs in the 5' UTR compared to variant 1. Variants 1-7 all encode isoform a. ##Evidence-Data-START## Transcript exon combination :: AF261138.1, AJ251095.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-17 DA091136.1 1-17 18-1484 AF261138.1 7-1473 1485-1509 AW571396.1 1-25 c FEATURES Location/Qualifiers source 1..1509 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="15" /map="15q25.1" gene 1..1509 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /note="zinc finger, AN1-type domain 6" /db_xref="GeneID:54469" /db_xref="HGNC:30164" /db_xref="MIM:610183" exon 1..87 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /inference="alignment:Splign:1.39.8" misc_feature 45..47 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /note="upstream in-frame stop codon" variation 48 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:139754318" exon 88..258 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /inference="alignment:Splign:1.39.8" variation 94 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:199824008" CDS 105..731 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /note="isoform a is encoded by transcript variant 6; zinc finger, A20 domain containing 3; protein associated with PRK1; AN1-type zinc finger protein 6" /codon_start=1 /product="AN1-type zinc finger protein 6 isoform a" /protein_id="NP_001229844.1" /db_xref="GI:339276069" /db_xref="CCDS:CCDS10313.1" /db_xref="GeneID:54469" /db_xref="HGNC:30164" /db_xref="MIM:610183" /translation="
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI
" misc_feature 135..209 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /note="A20-like zinc finger; Region: zf-A20; pfam01754" /db_xref="CDD:201955" misc_feature 549..662 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /note="AN1-like Zinc finger; Region: ZnF_AN1; smart00154" /db_xref="CDD:197545" variation 107 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:199812490" variation 161..162 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="" /replace="ttttt" /db_xref="dbSNP:377119303" variation 200 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:147450412" variation 209 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:180695554" variation 236 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:377732231" variation 245 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:370987142" exon 259..367 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /inference="alignment:Splign:1.39.8" variation 278 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:372075821" variation 299 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:56296028" variation 317 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="g" /replace="t" /db_xref="dbSNP:142826314" variation 337 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="" /replace="t" /db_xref="dbSNP:35882905" variation 357 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:201923212" exon 368..468 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /inference="alignment:Splign:1.39.8" variation 369 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:371672655" variation 374 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:112075519" variation 379 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="c" /db_xref="dbSNP:11554805" variation 391 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:368985546" variation 392 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:151059961" variation 400 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:200534739" variation 408 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="g" /replace="t" /db_xref="dbSNP:147509612" variation 422 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="g" /db_xref="dbSNP:201635973" variation 449 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:149918624" variation 452 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="c" /db_xref="dbSNP:146488669" exon 469..582 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /inference="alignment:Splign:1.39.8" variation 524 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="t" /db_xref="dbSNP:12577" variation 534 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:15416" exon 583..1496 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /inference="alignment:Splign:1.39.8" variation 636 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:141077255" variation 643 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:144905247" variation 670 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="g" /db_xref="dbSNP:371685766" variation 711 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:12890" variation 737 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="t" /db_xref="dbSNP:185069607" STS 900..1022 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /standard_name="RH94373" /db_xref="UniSTS:92596" variation 1064 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:147191208" variation 1073 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:189624188" variation 1281 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:115600191" variation 1311..1312 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="" /replace="t" /db_xref="dbSNP:201030333" variation 1324 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:181224064" variation 1345 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="c" /replace="t" /db_xref="dbSNP:186689879" variation 1410 /gene="ZFAND6" /gene_synonym="AWP1; ZA20D3; ZFAND5B" /replace="a" /replace="g" /db_xref="dbSNP:138866718" ORIGIN
ggtattcaggtttggttgctttggagtacagcttcaagtgaagttaatctgaggtgaagcaaacagaaaattgtggaggttttgttggtgtgcaactgaggaacatggctcaagaaactaatcacagccaagtgcctatgctttgttccactggctgtggattttatggaaaccctcgtacaaatggcatgtgttcagtatgctataaagaacatcttcaaagacagaatagtagtaatggtagaataagcccacctgcaacctctgtcagtagtctgtctgaatctttaccagttcaatgcacagatggcagtgtgccagaagcccagtcagcattagactctacatcttcatctatgcagcccagccctgtatcaaatcagtcacttttatcagaatctgtagcatcttctcaattggacagtacatctgtggacaaagcagtacctgaaacagaagatgtgcaggcttcagtatcagacacagcacagcagccatctgaagagcaaagcaagtctcttgaaaaaccgaaacaaaaaaagaatcgctgtttcatgtgcaggaagaaagtgggacttactgggtttgaatgccggtgtggaaatgtttactgtggtgtacaccgttactcagatgtacacaattgctcttacaattacaaagccgatgctgctgagaaaatcagaaaagaaaatccagtagttgttggtgaaaagatccaaaagatttgaactcctgctggaatacaaaattcttgagcatctgcaaactaaaaattgacttgaggttttttttttcctagtcattgggaatgtagagcagtgtatcttgcatgtcatcggaagaatagatttttgttttggttttgttttgaaaatgactctgaacatttatttccattgcaatttctgtggctgaggagacttaaactttacaagtattatccttttaagatcattttaattttagttgagtgcagagggcttttataacaaacgtgcagaaattttggagggctgtgatttttccagtattaaacatgcatgcattaatcttgcagtttattttctcattgtgtatgtatatatcgcttttctctgcagcacgatttctcttttgataatgccctttagggcacaactagttatcagtaactgaatgtatcttaatcattatggctgcttctgttttttcattaacaaaggttattcatatgttagcatatagtttctttgcacccactatttatgtctgaatcatttgtcacaagagagtgtgtgctgatgagattgtaagtttgtgtgtttaaacttttttttgagcgagggaagaaaaagctgtatgcatttcattgctgtctacaggtttctttcagattatgttcatgggtttgtgtgtatacaatatgaagaatgatctgaagtaattgtgctgtatttatgtttattcaccagtctttgattaaataaaaaggaaaaccagaatgctcccttgtaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:54469 -> Molecular function: GO:0003674 [molecular_function] evidence: ND GeneID:54469 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA GeneID:54469 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:54469 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA GeneID:54469 -> Molecular function: GO:0031593 [polyubiquitin binding] evidence: ISS GeneID:54469 -> Biological process: GO:0006625 [protein targeting to peroxisome] evidence: ISS GeneID:54469 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:54469 -> Biological process: GO:0008150 [biological_process] evidence: ND GeneID:54469 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IMP GeneID:54469 -> Biological process: GO:0043122 [regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IMP GeneID:54469 -> Biological process: GO:0071356 [cellular response to tumor necrosis factor] evidence: IMP GeneID:54469 -> Cellular component: GO:0005575 [cellular_component] evidence: ND GeneID:54469 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.