Home |
Help |
Advanced search
2024-04-25 06:30:10, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001242914 1673 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens zinc finger, AN1-type domain 6 (ZFAND6), transcript
variant 5, mRNA.
ACCESSION NM_001242914
VERSION NM_001242914.1 GI:339276066
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1673)
AUTHORS Chang,E.J., Ha,J., Kang,S.S., Lee,Z.H. and Kim,H.H.
TITLE AWP1 binds to tumor necrosis factor receptor-associated factor 2
(TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB
signaling
JOURNAL Int. J. Biochem. Cell Biol. 43 (11), 1612-1620 (2011)
PUBMED 21810480
REMARK GeneRIF: The AN1 domain of AWP1 mediated the functional interaction
with tumor necrosis factor receptor-associated factor 2, and the
A20 domain was responsible for the negative regulation of nuclear
factor kappaB activation.
REFERENCE 2 (bases 1 to 1673)
AUTHORS de Miguel-Yanes,J.M., Shrader,P., Pencina,M.J., Fox,C.S.,
Manning,A.K., Grant,R.W., Dupuis,J., Florez,J.C., D'Agostino,R.B.
Sr., Cupples,L.A. and Meigs,J.B.
CONSRTM MAGIC Investigators; DIAGRAM+ Investigators
TITLE Genetic risk reclassification for type 2 diabetes by age below or
above 50 years using 40 type 2 diabetes risk single nucleotide
polymorphisms
JOURNAL Diabetes Care 34 (1), 121-125 (2011)
PUBMED 20889853
REMARK GeneRIF: Observational study of gene-disease association, gene-gene
interaction, and gene-environment interaction. (HuGE Navigator)
REFERENCE 3 (bases 1 to 1673)
AUTHORS Cao,Y.K., Mo,Y.Y., Tian,F.Z., Liu,Y.W., Deng,P., Qin,Q.H. and
Jiang,Y.
TITLE [Construction of GFP-AWP1 fusion gene vector and its expression in
293 cells]
JOURNAL Di Yi Jun Yi Da Xue Xue Bao 25 (2), 174-176 (2005)
PUBMED 15698998
REFERENCE 4 (bases 1 to 1673)
AUTHORS Duan,W., Sun,B., Li,T.W., Tan,B.J., Lee,M.K. and Teo,T.S.
TITLE Cloning and characterization of AWP1, a novel protein that
associates with serine/threonine kinase PRK1 in vivo
JOURNAL Gene 256 (1-2), 113-121 (2000)
PUBMED 11054541
REFERENCE 5 (bases 1 to 1673)
AUTHORS Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and
Wiemann,S.
TITLE Systematic subcellular localization of novel proteins identified by
large-scale cDNA sequencing
JOURNAL EMBO Rep. 1 (3), 287-292 (2000)
PUBMED 11256614
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BI562073.1, BG720174.1, AC092701.2 and AW571396.1.
Transcript Variant: This variant (5) differs in the 5' UTR compared
to variant 1. Variants 1-7 all encode isoform a.
##Evidence-Data-START##
CDS exon combination :: BC005283.1, BX423171.2 [ECO:0000331]
RNAseq introns :: single sample supports all introns
ERS025085 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-9 BI562073.1 15-23
10-715 BG720174.1 7-712
716-746 AC092701.2 14118-14148 c
747-1648 AC092701.2 7030-7931 c
1649-1673 AW571396.1 1-25 c
FEATURES Location/Qualifiers
source 1..1673
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="15"
/map="15q25.1"
gene 1..1673
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/note="zinc finger, AN1-type domain 6"
/db_xref="GeneID:54469"
/db_xref="HGNC:30164"
/db_xref="MIM:610183"
exon 1..88
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/inference="alignment:Splign:1.39.8"
variation 11
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:144721443"
variation 65
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:28759351"
variation 86
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:369660483"
exon 89..251
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/inference="alignment:Splign:1.39.8"
variation 97
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:56884096"
variation 117
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="t"
/db_xref="dbSNP:181644579"
misc_feature 200..202
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/note="upstream in-frame stop codon"
exon 252..422
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/inference="alignment:Splign:1.39.8"
variation 258
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:199824008"
CDS 269..895
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/note="isoform a is encoded by transcript variant 5; zinc
finger, A20 domain containing 3; protein associated with
PRK1; AN1-type zinc finger protein 6"
/codon_start=1
/product="AN1-type zinc finger protein 6 isoform a"
/protein_id="NP_001229843.1"
/db_xref="GI:339276067"
/db_xref="CCDS:CCDS10313.1"
/db_xref="GeneID:54469"
/db_xref="HGNC:30164"
/db_xref="MIM:610183"
/translation="
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI
"
misc_feature 299..373
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/note="A20-like zinc finger; Region: zf-A20; pfam01754"
/db_xref="CDD:201955"
misc_feature 713..826
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/note="AN1-like Zinc finger; Region: ZnF_AN1; smart00154"
/db_xref="CDD:197545"
variation 271
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:199812490"
variation 325..326
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace=""
/replace="ttttt"
/db_xref="dbSNP:377119303"
variation 364
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:147450412"
variation 373
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:180695554"
variation 400
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:377732231"
variation 409
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:370987142"
exon 423..531
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/inference="alignment:Splign:1.39.8"
variation 442
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:372075821"
variation 463
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:56296028"
variation 481
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="g"
/replace="t"
/db_xref="dbSNP:142826314"
variation 501
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace=""
/replace="t"
/db_xref="dbSNP:35882905"
variation 521
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:201923212"
exon 532..632
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/inference="alignment:Splign:1.39.8"
variation 533
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:371672655"
variation 538
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:112075519"
variation 543
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="c"
/db_xref="dbSNP:11554805"
variation 555
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:368985546"
variation 556
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:151059961"
variation 564
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:200534739"
variation 572
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="g"
/replace="t"
/db_xref="dbSNP:147509612"
variation 586
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="g"
/db_xref="dbSNP:201635973"
variation 613
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:149918624"
variation 616
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="c"
/db_xref="dbSNP:146488669"
exon 633..746
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/inference="alignment:Splign:1.39.8"
variation 688
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="t"
/db_xref="dbSNP:12577"
variation 698
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:15416"
exon 747..1660
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/inference="alignment:Splign:1.39.8"
variation 800
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:141077255"
variation 807
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:144905247"
variation 834
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="g"
/db_xref="dbSNP:371685766"
variation 875
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:12890"
variation 901
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="t"
/db_xref="dbSNP:185069607"
STS 1064..1186
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/standard_name="RH94373"
/db_xref="UniSTS:92596"
variation 1228
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:147191208"
variation 1237
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:189624188"
variation 1445
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:115600191"
variation 1475..1476
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace=""
/replace="t"
/db_xref="dbSNP:201030333"
variation 1488
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:181224064"
variation 1509
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="c"
/replace="t"
/db_xref="dbSNP:186689879"
variation 1574
/gene="ZFAND6"
/gene_synonym="AWP1; ZA20D3; ZFAND5B"
/replace="a"
/replace="g"
/db_xref="dbSNP:138866718"
ORIGIN
agcgggttgcgagcggttggctggcgggggtcggaagggccccgggcacactggggcgcgtcagttccccgcctcctccgagtctcaggaatgaatctgaagtctgctgcagtaaaacacagaaggctttaaaatgttttcttgcataaaattcaaaacttttaagtagctgcttatgagaatagggaaggcagaaagctaatgtctgtctcaagatacaggacagctgtttgctcatcaacctcaactgtgtgtgcaactgaggaacatggctcaagaaactaatcacagccaagtgcctatgctttgttccactggctgtggattttatggaaaccctcgtacaaatggcatgtgttcagtatgctataaagaacatcttcaaagacagaatagtagtaatggtagaataagcccacctgcaacctctgtcagtagtctgtctgaatctttaccagttcaatgcacagatggcagtgtgccagaagcccagtcagcattagactctacatcttcatctatgcagcccagccctgtatcaaatcagtcacttttatcagaatctgtagcatcttctcaattggacagtacatctgtggacaaagcagtacctgaaacagaagatgtgcaggcttcagtatcagacacagcacagcagccatctgaagagcaaagcaagtctcttgaaaaaccgaaacaaaaaaagaatcgctgtttcatgtgcaggaagaaagtgggacttactgggtttgaatgccggtgtggaaatgtttactgtggtgtacaccgttactcagatgtacacaattgctcttacaattacaaagccgatgctgctgagaaaatcagaaaagaaaatccagtagttgttggtgaaaagatccaaaagatttgaactcctgctggaatacaaaattcttgagcatctgcaaactaaaaattgacttgaggttttttttttcctagtcattgggaatgtagagcagtgtatcttgcatgtcatcggaagaatagatttttgttttggttttgttttgaaaatgactctgaacatttatttccattgcaatttctgtggctgaggagacttaaactttacaagtattatccttttaagatcattttaattttagttgagtgcagagggcttttataacaaacgtgcagaaattttggagggctgtgatttttccagtattaaacatgcatgcattaatcttgcagtttattttctcattgtgtatgtatatatcgcttttctctgcagcacgatttctcttttgataatgccctttagggcacaactagttatcagtaactgaatgtatcttaatcattatggctgcttctgttttttcattaacaaaggttattcatatgttagcatatagtttctttgcacccactatttatgtctgaatcatttgtcacaagagagtgtgtgctgatgagattgtaagtttgtgtgtttaaacttttttttgagcgagggaagaaaaagctgtatgcatttcattgctgtctacaggtttctttcagattatgttcatgggtttgtgtgtatacaatatgaagaatgatctgaagtaattgtgctgtatttatgtttattcaccagtctttgattaaataaaaaggaaaaccagaatgctcccttgtaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:54469 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
GeneID:54469 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
GeneID:54469 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:54469 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
GeneID:54469 -> Molecular function: GO:0031593 [polyubiquitin binding] evidence: ISS
GeneID:54469 -> Biological process: GO:0006625 [protein targeting to peroxisome] evidence: ISS
GeneID:54469 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:54469 -> Biological process: GO:0008150 [biological_process] evidence: ND
GeneID:54469 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IMP
GeneID:54469 -> Biological process: GO:0043122 [regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IMP
GeneID:54469 -> Biological process: GO:0071356 [cellular response to tumor necrosis factor] evidence: IMP
GeneID:54469 -> Cellular component: GO:0005575 [cellular_component] evidence: ND
GeneID:54469 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.