2024-04-26 08:18:06, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001204869 4739 bp mRNA linear PRI 24-JUN-2013 DEFINITION Homo sapiens WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 3, mRNA. ACCESSION NM_001204869 VERSION NM_001204869.1 GI:325910842 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 4739) AUTHORS Liu,J.F., Hou,S.M., Tsai,C.H., Huang,C.Y., Hsu,C.J. and Tang,C.H. TITLE CCN4 induces vascular cell adhesion molecule-1 expression in human synovial fibroblasts and promotes monocyte adhesion JOURNAL Biochim. Biophys. Acta 1833 (5), 966-975 (2013) PUBMED 23313051 REMARK GeneRIF: The CCN4-induced VCAM-1 expression promoted monocyte adhesion to human OASFs. REFERENCE 2 (bases 1 to 4739) AUTHORS Saxena,R., Saleheen,D., Been,L.F., Garavito,M.L., Braun,T., Bjonnes,A., Young,R., Ho,W.K., Rasheed,A., Frossard,P., Sim,X., Hassanali,N., Radha,V., Chidambaram,M., Liju,S., Rees,S.D., Ng,D.P., Wong,T.Y., Yamauchi,T., Hara,K., Tanaka,Y., Hirose,H., McCarthy,M.I., Morris,A.P., Basit,A., Barnett,A.H., Katulanda,P., Matthews,D., Mohan,V., Wander,G.S., Singh,J.R., Mehra,N.K., Ralhan,S., Kamboh,M.I., Mulvihill,J.J., Maegawa,H., Tobe,K., Maeda,S., Cho,Y.S., Tai,E.S., Kelly,M.A., Chambers,J.C., Kooner,J.S., Kadowaki,T., Deloukas,P., Rader,D.J., Danesh,J. and Sanghera,D.K. CONSRTM DIAGRAM; MuTHER; AGEN TITLE Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India JOURNAL Diabetes 62 (5), 1746-1755 (2013) PUBMED 23300278 REFERENCE 3 (bases 1 to 4739) AUTHORS Zemans,R.L., McClendon,J., Aschner,Y., Briones,N., Young,S.K., Lau,L.F., Kahn,M. and Downey,G.P. TITLE Role of beta-catenin-regulated CCN matricellular proteins in epithelial repair after inflammatory lung injury JOURNAL Am. J. Physiol. Lung Cell Mol. Physiol. 304 (6), L415-L427 (2013) PUBMED 23316072 REMARK GeneRIF: Beta-catenin-dependent expression of WISP1 and Cyr61 is critical for epithelial repair. REFERENCE 4 (bases 1 to 4739) AUTHORS Hennemeier,I., Humpf,H.U., Gekle,M. and Schwerdt,G. TITLE The food contaminant and nephrotoxin ochratoxin A enhances Wnt1 inducible signaling protein 1 and tumor necrosis factor-alpha expression in human primary proximal tubule cells JOURNAL Mol Nutr Food Res 56 (9), 1375-1384 (2012) PUBMED 22778029 REMARK GeneRIF: Prolonged exposure of kidney cells to ochratoxin A, expectable in human kidney due to a normal diet, leads to a marked ERK1/2-dependent upregulation of WISP1 gene expression, which, accompanied by increased ERK1/2- dependent TNF-alpha expression. REFERENCE 5 (bases 1 to 4739) AUTHORS Shao,H., Cai,L., Grichnik,J.M., Livingstone,A.S., Velazquez,O.C. and Liu,Z.J. TITLE Activation of Notch1 signaling in stromal fibroblasts inhibits melanoma growth by upregulating WISP-1 JOURNAL Oncogene 30 (42), 4316-4326 (2011) PUBMED 21516124 REMARK GeneRIF: This study shows that constitutive activation of the Notch1 pathway confers fibroblasts with a suppressive phenotype to melanoma growth, partially through WISP-1. REFERENCE 6 (bases 1 to 4739) AUTHORS Xie,D., Nakachi,K., Wang,H., Elashoff,R. and Koeffler,H.P. TITLE Elevated levels of connective tissue growth factor, WISP-1, and CYR61 in primary breast cancers associated with more advanced features JOURNAL Cancer Res. 61 (24), 8917-8923 (2001) PUBMED 11751417 REMARK GeneRIF: Elevated levels of connective tissue growth factor, WISP-1, and CYR61 in primary breast cancers associated with more advanced features. REFERENCE 7 (bases 1 to 4739) AUTHORS Desnoyers,L., Arnott,D. and Pennica,D. TITLE WISP-1 binds to decorin and biglycan JOURNAL J. Biol. Chem. 276 (50), 47599-47607 (2001) PUBMED 11598131 REFERENCE 8 (bases 1 to 4739) AUTHORS Tanaka,S., Sugimachi,K., Saeki,H., Kinoshita,J., Ohga,T., Shimada,M., Maehara,Y. and Sugimachi,K. TITLE A novel variant of WISP1 lacking a Von Willebrand type C module overexpressed in scirrhous gastric carcinoma JOURNAL Oncogene 20 (39), 5525-5532 (2001) PUBMED 11571650 REFERENCE 9 (bases 1 to 4739) AUTHORS Xu,L., Corcoran,R.B., Welsh,J.W., Pennica,D. and Levine,A.J. TITLE WISP-1 is a Wnt-1- and beta-catenin-responsive oncogene JOURNAL Genes Dev. 14 (5), 585-595 (2000) PUBMED 10716946 REFERENCE 10 (bases 1 to 4739) AUTHORS Pennica,D., Swanson,T.A., Welsh,J.W., Roy,M.A., Lawrence,D.A., Lee,J., Brush,J., Taneyhill,L.A., Deuel,B., Lew,M., Watanabe,C., Cohen,R.L., Melhem,M.F., Finley,G.G., Quirke,P., Goddard,A.D., Hillan,K.J., Gurney,A.L., Botstein,D. and Levine,A.J. TITLE WISP genes are members of the connective tissue growth factor family that are up-regulated in wnt-1-transformed cells and aberrantly expressed in human colon tumors JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (25), 14717-14722 (1998) PUBMED 9843955 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BX476382.1, AY196488.1, AB034725.1, AF192304.6 and AI347990.1. Summary: This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. It is expressed at a high level in fibroblast cells, and overexpressed in colon tumors. The encoded protein binds to decorin and biglycan, two members of a family of small leucine-rich proteoglycans present in the extracellular matrix of connective tissue, and possibly prevents the inhibitory activity of decorin and biglycan in tumor cell proliferation. It also attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase. It is 83% identical to the mouse protein at the amino acid level. Multiple alternatively spliced transcript variants have been identified. [provided by RefSeq, Mar 2011]. Transcript Variant: This variant (3) lacks two consecutive exons in the coding region, as compared to variant 1. The resulting isoform (3) has a shorter and distinct C-terminus, as compared to isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AY196488.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025088, ERS025090 [ECO:0000350] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-45 BX476382.1 1-45 46-377 AY196488.1 1-332 378-455 AB034725.1 280-357 456-4459 AF192304.6 65534-69537 4460-4739 AI347990.1 1-280 c FEATURES Location/Qualifiers source 1..4739 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="8" /map="8q24.22" gene 1..4739 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /note="WNT1 inducible signaling pathway protein 1" /db_xref="GeneID:8840" /db_xref="HGNC:12769" /db_xref="MIM:603398" exon 1..175 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /inference="alignment:Splign:1.39.8" variation 22 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:35244636" variation 55 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:116716037" STS 57..805 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /db_xref="UniSTS:481399" variation 58 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="c" /db_xref="dbSNP:113859079" variation 60 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:201515187" variation 76 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:370168550" variation 77 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:373840690" STS 78..776 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /db_xref="UniSTS:482064" misc_feature 95..97 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /note="upstream in-frame stop codon" CDS 107..574 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /note="isoform 3 precursor is encoded by transcript variant 3; Wnt-1 inducible signaling pathway protein 1; WNT1 induced secreted protein 1; CCN family member 4" /codon_start=1 /product="WNT1-inducible-signaling pathway protein 1 isoform 3 precursor" /protein_id="NP_001191798.1" /db_xref="GI:325910843" /db_xref="CCDS:CCDS56555.1" /db_xref="GeneID:8840" /db_xref="HGNC:12769" /db_xref="MIM:603398" /translation="
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCARREEVSGCVPARGIHELHTCGLHQHTLLSTQVLWSLHGQ
" sig_peptide 107..172 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 173..571 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /product="WNT1-inducible-signaling pathway protein 1 isoform 3" misc_feature <299..409 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /note="Insulin-like growth factor binding protein; Region: IGFBP; pfam00219" /db_xref="CDD:201091" variation 128 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:145302227" variation 130 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:147864416" variation 134 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:141541463" variation 135 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="c" /db_xref="dbSNP:147047617" variation 140 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:145240649" variation 144 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:149172980" variation 155 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:375956639" variation 174 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:370536589" variation 175 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:374241755" exon 176..455 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /inference="alignment:Splign:1.39.8" variation 190 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:201677592" variation 195 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:148354420" variation 200 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:371604351" variation 229 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:73711808" variation 247 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:200725711" variation 285 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:145895971" variation 286 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="c" /db_xref="dbSNP:138500919" variation 292 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:61526601" variation 344 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:150518640" variation 359 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:202221836" variation 397 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:73711810" variation 403 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:114585111" variation 436 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:367939319" exon 456..4735 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /inference="alignment:Splign:1.39.8" variation 499 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:370616029" variation 506 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:35938742" variation 514 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:374293123" variation 515 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:34279368" variation 544 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="c" /db_xref="dbSNP:368398252" variation 548 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:150347257" variation 572 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:3739261" variation 587 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:369316693" variation 621 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:200845163" variation 646 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:371947572" variation 656 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:34665171" variation 707 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:146812236" variation 749 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:140629356" variation 757 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:192420341" variation 777 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:200836970" variation 782 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:374163879" variation 900 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:138013484" variation 1010 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:57390041" variation 1124 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="" /replace="a" /db_xref="dbSNP:142394577" variation 1206 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:113549310" variation 1231 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:184580529" variation 1348 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="c" /db_xref="dbSNP:190313906" variation 1396 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:142461254" variation 1499 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:2929969" variation 1725 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:12164193" variation 1734 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:145960909" variation 1740 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:73362554" variation 1809 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="c" /db_xref="dbSNP:182003497" variation 1888 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:4265166" variation 1939 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:2929970" variation 2008 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:374010309" variation 2013 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:4577938" variation 2104 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="t" /db_xref="dbSNP:377032724" variation 2218 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:146162433" variation 2273 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:185849289" variation 2569 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:188945068" variation 2578 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:181057409" variation 2581 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:148796937" variation 2802 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:117072299" variation 2835 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:2977549" variation 3138 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:73362557" variation 3140 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:76779268" variation 3174 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:2929971" variation 3181 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:373530385" variation 3205 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:142427022" variation 3257 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:2929972" variation 3310 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:2929973" variation 3334 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:151300566" variation 3482 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:16904856" variation 3513..3514 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="" /replace="c" /db_xref="dbSNP:36017627" variation 3569 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:370468302" variation 3611 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:2977550" variation 3726 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:9649971" variation 3728 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:186406622" variation 3758 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:16904857" variation 3847 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:191533905" variation 3881 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:200715437" variation 3909 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:145461011" variation 4050 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:16904858" variation 4158 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:114925013" variation 4168 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:16904859" variation 4224 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="t" /db_xref="dbSNP:73711826" variation 4226..4227 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="" /replace="g" /db_xref="dbSNP:35647766" variation 4231 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:16904860" variation 4244..4247 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="" /replace="ctga" /db_xref="dbSNP:372155216" variation 4246..4249 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="" /replace="gact" /db_xref="dbSNP:367926394" variation 4270 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:182511484" variation 4287 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:186242527" variation 4333 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="g" /db_xref="dbSNP:74818902" variation 4352 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="c" /replace="t" /db_xref="dbSNP:2977551" STS 4417..4583 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /standard_name="RH102883" /db_xref="UniSTS:97217" STS 4431..4642 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /standard_name="RH76344" /db_xref="UniSTS:92556" variation 4464 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="g" /replace="t" /db_xref="dbSNP:147688784" variation 4476 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:191950359" variation 4641 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" /replace="a" /replace="g" /db_xref="dbSNP:77866098" polyA_signal 4713..4718 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" polyA_site 4735 /gene="WISP1" /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc" ORIGIN
atatctggtgctcctgatgggccggccagtctgggcccagctcccccgagaggtggtcggatcctctgggctgctcggtcgatgcctgtgccactgacgtccaggcatgaggtggttcctgccctggacgctggcagcagtgacagcagcagccgccagcaccgtcctggccacggccctctctccagcccctacgaccatggactttaccccagctccactggaggacacctcctcacgcccccaattctgcaagtggccatgtgagtgcccgccatccccaccccgctgcccgctgggggtcagcctcatcacagatggctgtgagtgctgtaagatgtgcgctcagcagcttggggacaactgcacggaggctgccatctgtgacccccaccggggcctctactgtgactacagcggggaccgcccgaggtacgcaataggagtgtgtgcacgcagggaagaagtgtctggctgtgtaccagccagaggcatccatgaacttcacacttgcgggctgcatcagcacacgctcctatcaacccaagtactgtggagtttgcatggacaataggtgctgcatcccctacaagtctaagactatcgacgtgtccttccagtgtcctgatgggcttggcttctcccgccaggtcctatggattaatgcctgcttctgtaacctgagctgtaggaatcccaatgacatctttgctgacttggaatcctaccctgacttctcagaaattgccaactaggcaggcacaaatcttgggtcttggggactaacccaatgcctgtgaagcagtcagcccttatggccaataacttttcaccaatgagccttagttaccctgatctggacccttggcctccatttctgtctctaaccattcaaatgacgcctgatggtgctgctcaggcccatgctatgagttttctccttgatatcattcagcatctactctaaagaaaaatgcctgtctctagctgttctggactacacccaagcctgatccagcctttccaagtcactagaagtcctgctggatcttgcctaaatcccaagaaatggaatcaggtagacttttaatatcactaatttcttctttagatgccaaaccacaagactctttgggtccattcagatgaatagatggaatttggaacaatagaataatctattatttggagcctgccaagaggtactgtaatgggtaattctgacgtcagcgcaccaaaactatcctgattccaaatatgtatgcacctcaaggtcatcaaacatttgccaagtgagttgaatagttgcttaattttgatttttaatggaaagttgtatccattaacctgggcattgttgaggttaagtttctcttcacccctacactgtgaagggtacagattaggtttgtcccagtcagaaataaaatttgataaacattcctgttgatgggaaaagcccccagttaatactccagagacagggaaaggtcagcccgtttcagaaggaccaattgactctcacactgaatcagctgctgactggcagggctttgggcagttggccaggctcttccttgaatcttctcccttgtcctgcttggggttcataggaattggtaaggcctctggactggcctgtctggcccctgagagtggtgccctggaacactcctctactcttacagagccttgagagacccagctgcagaccatgccagacccactgaaatgaccaagacaggttcaggtaggggtgtgggtcaaaccaagaagtgggtgcccttggtagcagcctggggtgacctctagagctggaggctgtgggactccaggggcccccgtgttcaggacacatctattgcagagactcatttcacagcctttcgttctgctgaccaaatggccagttttctggtaggaagatggaggtttaccggttgtttagaaacagaaatagacttaataaaggtttaaagctgaagaggttgaagctaaaaggaaaaggttgttgttaatgaatatcaggctattatttattgtattaggaaaatataatatttactgttagaattcttttatttagggccttttctgtgccagacattgctctcagtgctttgcatgtattagctcactgaatcttcacgacaatgttgagaagttcccattattatttctgttcttacaaatgtgaaacggaagctcatagaggtgagaaaactcaaccagagtcacccagttggtgactgggaaagttaggattcagatcgaaattggactgtctttataacccatattttccccctgtttttagagcttccaaatgtgtcagaataggaaaacattgcaataaatggcttgattttttaatgtcatttttccctcttatagtctttctagctccttttcaaaagacgagaatatctgattttctgataatttaggtgcttaagcatccaaaatacatgggacacacaaaaatccaggaatcccctgtagcttattccctctttcccatcggaaccagctctcatcacacatttaaaagatgattctgtttacccaatgctgcatattgaatgttgtgtagttattcacagggaattctgtgcagtgtgcagagagattcctaaacgggaaaaggactgggaatacatcctccttactgtgacctccccaaaacctagtccagtgcaaggtatacagtggtgctcattaaatacttgatgaatacaggaagctgtgcatgtgttcctacttttattcgaagctctcttcttccaaagctacatgaaaatagaattttaacagtcaaaattttatattaagtgccttagcaaaagagacatttaatatttcaaagaaatgcatatgtatgtatacatatatttgtgtatgcgtatgcaagaattcttgtataaagagaattcactccatgaatgatctcttctgtaagtcagtgtgaatcatgttagattttctgagagtgaaaacacctgccatctacaaattacaaggctggataacagctcactccatttgaaattcagtggaaacccaagagctaggttcttactgaatttgcatctcaatttgggaaactgaacttagctttcaaagatcataggaagtctggttggagaaactagggattattctggcaatgggtgcaggaaggtggtcagaataacccagtcgccattggttttgagaaacggaactatcttatgcagagcccggagggcaagtctcagacccatgggttgaagccatggagaaggaaatttggatccaatgtaatgaagcgctttctaagtcagaatttccctgcaatggtgtggcctgattcaataaaaattaagaataataaatataatggaaaaaaatctccactgattgagtgtttacttggtgccaagcactatgctaagttgttcattattttatttaattgttacagcaattttgagtatgcatctttcactattttataagtggaaaagagaagtgcccccaaaaagttagagctcaaacagcagcttattctaccagcccctgctcttgcggaggcctctggaaaagacctgaatgacacctattggagaattacatctacaaggggcttcaaacagaccaaatagatcatcacctctgtggtcccttgttaactatatgttctgagacaaaggaaagctaccctaagggttagttaacctttgctgaggaaatttacattcatacttagagtgaattactcaggtgtgcttaggtgtgcaaaagggaaggagacctgaattcaccaagttaaatcttgctaaaccttatcataagcattttttgagcgcttagcatacaccaagccttgtggaaggtgctttcctgccatatctcatttaatcctcacagcaaacctatagaatatggcattatcatctgagtctcacagaagtttagtcgtgtactcaaggtcttaccagctagtgaacagcagaccaagactggaaacccaggatagtctgatacctgagccatctcttcttgtgctacgcctagttattctgtcccccaaatcaaaaggcatgacctttataagaggcgctttactgacaatagctgcaattttaactttgaaaatgattcagaattatcaaagatagtagattcgaatgacatgattgtctataatctcgctagccttgtactgtgtgtgcatagcaattacagggaagtaatctagctcctgactattatgttgaactatgtcgctgctttttacaaacttgtcttgatccaaagcagtcacaatgataaccctgcatatctgggaatcataagtcaactatgtatccctgtgtgtgtatatatatgtatgtatgtatctattttcaaactgtgatttaatatttaaatattcctactgccatttttgtgactgaaaaactacacatgaggaaacgtcttagaattttccaatagaggaaaaataacacttgggcaatctgtcatgtttcacaacagttctcatttttctcatgatttgtgtagcgtggaatgtgtttgctcaatgtgaagggttttcattgctcaatttctctgtgtaagtcttttccttaaggtaataaaccatcagcaaagtcacatactggagttggtggcttttcttgtacaggcagttgttatgagacaatgatggagcattgagcatgttcaataaatgtgcagatggtggaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8840 -> Molecular function: GO:0005520 [insulin-like growth factor binding] evidence: IEA GeneID:8840 -> Biological process: GO:0001558 [regulation of cell growth] evidence: IEA GeneID:8840 -> Biological process: GO:0007155 [cell adhesion] evidence: IEA GeneID:8840 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:8840 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS GeneID:8840 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA GeneID:8840 -> Cellular component: GO:0005615 [extracellular space] evidence: NAS GeneID:8840 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.