GGRNA Home | Help | Advanced search

2024-05-04 19:19:50, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001204869            4739 bp    mRNA    linear   PRI 24-JUN-2013
DEFINITION  Homo sapiens WNT1 inducible signaling pathway protein 1 (WISP1),
            transcript variant 3, mRNA.
ACCESSION   NM_001204869
VERSION     NM_001204869.1  GI:325910842
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4739)
  AUTHORS   Liu,J.F., Hou,S.M., Tsai,C.H., Huang,C.Y., Hsu,C.J. and Tang,C.H.
  TITLE     CCN4 induces vascular cell adhesion molecule-1 expression in human
            synovial fibroblasts and promotes monocyte adhesion
  JOURNAL   Biochim. Biophys. Acta 1833 (5), 966-975 (2013)
   PUBMED   23313051
  REMARK    GeneRIF: The CCN4-induced VCAM-1 expression promoted monocyte
            adhesion to human OASFs.
REFERENCE   2  (bases 1 to 4739)
  AUTHORS   Saxena,R., Saleheen,D., Been,L.F., Garavito,M.L., Braun,T.,
            Bjonnes,A., Young,R., Ho,W.K., Rasheed,A., Frossard,P., Sim,X.,
            Hassanali,N., Radha,V., Chidambaram,M., Liju,S., Rees,S.D.,
            Ng,D.P., Wong,T.Y., Yamauchi,T., Hara,K., Tanaka,Y., Hirose,H.,
            McCarthy,M.I., Morris,A.P., Basit,A., Barnett,A.H., Katulanda,P.,
            Matthews,D., Mohan,V., Wander,G.S., Singh,J.R., Mehra,N.K.,
            Ralhan,S., Kamboh,M.I., Mulvihill,J.J., Maegawa,H., Tobe,K.,
            Maeda,S., Cho,Y.S., Tai,E.S., Kelly,M.A., Chambers,J.C.,
            Kooner,J.S., Kadowaki,T., Deloukas,P., Rader,D.J., Danesh,J. and
            Sanghera,D.K.
  CONSRTM   DIAGRAM; MuTHER; AGEN
  TITLE     Genome-wide association study identifies a novel locus contributing
            to type 2 diabetes susceptibility in Sikhs of Punjabi origin from
            India
  JOURNAL   Diabetes 62 (5), 1746-1755 (2013)
   PUBMED   23300278
REFERENCE   3  (bases 1 to 4739)
  AUTHORS   Zemans,R.L., McClendon,J., Aschner,Y., Briones,N., Young,S.K.,
            Lau,L.F., Kahn,M. and Downey,G.P.
  TITLE     Role of beta-catenin-regulated CCN matricellular proteins in
            epithelial repair after inflammatory lung injury
  JOURNAL   Am. J. Physiol. Lung Cell Mol. Physiol. 304 (6), L415-L427 (2013)
   PUBMED   23316072
  REMARK    GeneRIF: Beta-catenin-dependent expression of WISP1 and Cyr61 is
            critical for epithelial repair.
REFERENCE   4  (bases 1 to 4739)
  AUTHORS   Hennemeier,I., Humpf,H.U., Gekle,M. and Schwerdt,G.
  TITLE     The food contaminant and nephrotoxin ochratoxin A enhances Wnt1
            inducible signaling protein 1 and tumor necrosis factor-alpha
            expression in human primary proximal tubule cells
  JOURNAL   Mol Nutr Food Res 56 (9), 1375-1384 (2012)
   PUBMED   22778029
  REMARK    GeneRIF: Prolonged exposure of kidney cells to ochratoxin A,
            expectable in human kidney due to a normal diet, leads to a marked
            ERK1/2-dependent upregulation of WISP1 gene expression, which,
            accompanied by increased ERK1/2- dependent TNF-alpha expression.
REFERENCE   5  (bases 1 to 4739)
  AUTHORS   Shao,H., Cai,L., Grichnik,J.M., Livingstone,A.S., Velazquez,O.C.
            and Liu,Z.J.
  TITLE     Activation of Notch1 signaling in stromal fibroblasts inhibits
            melanoma growth by upregulating WISP-1
  JOURNAL   Oncogene 30 (42), 4316-4326 (2011)
   PUBMED   21516124
  REMARK    GeneRIF: This study shows that constitutive activation of the
            Notch1 pathway confers fibroblasts with a suppressive phenotype to
            melanoma growth, partially through WISP-1.
REFERENCE   6  (bases 1 to 4739)
  AUTHORS   Xie,D., Nakachi,K., Wang,H., Elashoff,R. and Koeffler,H.P.
  TITLE     Elevated levels of connective tissue growth factor, WISP-1, and
            CYR61 in primary breast cancers associated with more advanced
            features
  JOURNAL   Cancer Res. 61 (24), 8917-8923 (2001)
   PUBMED   11751417
  REMARK    GeneRIF: Elevated levels of connective tissue growth factor,
            WISP-1, and CYR61 in primary breast cancers associated with more
            advanced features.
REFERENCE   7  (bases 1 to 4739)
  AUTHORS   Desnoyers,L., Arnott,D. and Pennica,D.
  TITLE     WISP-1 binds to decorin and biglycan
  JOURNAL   J. Biol. Chem. 276 (50), 47599-47607 (2001)
   PUBMED   11598131
REFERENCE   8  (bases 1 to 4739)
  AUTHORS   Tanaka,S., Sugimachi,K., Saeki,H., Kinoshita,J., Ohga,T.,
            Shimada,M., Maehara,Y. and Sugimachi,K.
  TITLE     A novel variant of WISP1 lacking a Von Willebrand type C module
            overexpressed in scirrhous gastric carcinoma
  JOURNAL   Oncogene 20 (39), 5525-5532 (2001)
   PUBMED   11571650
REFERENCE   9  (bases 1 to 4739)
  AUTHORS   Xu,L., Corcoran,R.B., Welsh,J.W., Pennica,D. and Levine,A.J.
  TITLE     WISP-1 is a Wnt-1- and beta-catenin-responsive oncogene
  JOURNAL   Genes Dev. 14 (5), 585-595 (2000)
   PUBMED   10716946
REFERENCE   10 (bases 1 to 4739)
  AUTHORS   Pennica,D., Swanson,T.A., Welsh,J.W., Roy,M.A., Lawrence,D.A.,
            Lee,J., Brush,J., Taneyhill,L.A., Deuel,B., Lew,M., Watanabe,C.,
            Cohen,R.L., Melhem,M.F., Finley,G.G., Quirke,P., Goddard,A.D.,
            Hillan,K.J., Gurney,A.L., Botstein,D. and Levine,A.J.
  TITLE     WISP genes are members of the connective tissue growth factor
            family that are up-regulated in wnt-1-transformed cells and
            aberrantly expressed in human colon tumors
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (25), 14717-14722 (1998)
   PUBMED   9843955
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BX476382.1, AY196488.1,
            AB034725.1, AF192304.6 and AI347990.1.
            
            Summary: This gene encodes a member of the WNT1 inducible signaling
            pathway (WISP) protein subfamily, which belongs to the connective
            tissue growth factor (CTGF) family. WNT1 is a member of a family of
            cysteine-rich, glycosylated signaling proteins that mediate diverse
            developmental processes. The CTGF family members are characterized
            by four conserved cysteine-rich domains: insulin-like growth
            factor-binding domain, von Willebrand factor type C module,
            thrombospondin domain and C-terminal cystine knot-like domain. This
            gene may be downstream in the WNT1 signaling pathway that is
            relevant to malignant transformation. It is expressed at a high
            level in fibroblast cells, and overexpressed in colon tumors. The
            encoded protein binds to decorin and biglycan, two members of a
            family of small leucine-rich proteoglycans present in the
            extracellular matrix of connective tissue, and possibly prevents
            the inhibitory activity of decorin and biglycan in tumor cell
            proliferation. It also attenuates p53-mediated apoptosis in
            response to DNA damage through activation of the Akt kinase. It is
            83% identical to the mouse protein at the amino acid level.
            Multiple alternatively spliced transcript variants have been
            identified. [provided by RefSeq, Mar 2011].
            
            Transcript Variant: This variant (3) lacks two consecutive exons in
            the coding region, as compared to variant 1. The resulting isoform
            (3) has a shorter and distinct C-terminus, as compared to isoform
            1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY196488.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025088, ERS025090 [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-45                BX476382.1         1-45
            46-377              AY196488.1         1-332
            378-455             AB034725.1         280-357
            456-4459            AF192304.6         65534-69537
            4460-4739           AI347990.1         1-280               c
FEATURES             Location/Qualifiers
     source          1..4739
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q24.22"
     gene            1..4739
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /note="WNT1 inducible signaling pathway protein 1"
                     /db_xref="GeneID:8840"
                     /db_xref="HGNC:12769"
                     /db_xref="MIM:603398"
     exon            1..175
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /inference="alignment:Splign:1.39.8"
     variation       22
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35244636"
     variation       55
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:116716037"
     STS             57..805
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /db_xref="UniSTS:481399"
     variation       58
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113859079"
     variation       60
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201515187"
     variation       76
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370168550"
     variation       77
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373840690"
     STS             78..776
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /db_xref="UniSTS:482064"
     misc_feature    95..97
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /note="upstream in-frame stop codon"
     CDS             107..574
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /note="isoform 3 precursor is encoded by transcript
                     variant 3; Wnt-1 inducible signaling pathway protein 1;
                     WNT1 induced secreted protein 1; CCN family member 4"
                     /codon_start=1
                     /product="WNT1-inducible-signaling pathway protein 1
                     isoform 3 precursor"
                     /protein_id="NP_001191798.1"
                     /db_xref="GI:325910843"
                     /db_xref="CCDS:CCDS56555.1"
                     /db_xref="GeneID:8840"
                     /db_xref="HGNC:12769"
                     /db_xref="MIM:603398"
                     /translation="
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCARREEVSGCVPARGIHELHTCGLHQHTLLSTQVLWSLHGQ
"
     sig_peptide     107..172
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     173..571
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /product="WNT1-inducible-signaling pathway protein 1
                     isoform 3"
     misc_feature    <299..409
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /note="Insulin-like growth factor binding protein; Region:
                     IGFBP; pfam00219"
                     /db_xref="CDD:201091"
     variation       128
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145302227"
     variation       130
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147864416"
     variation       134
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141541463"
     variation       135
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147047617"
     variation       140
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145240649"
     variation       144
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149172980"
     variation       155
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375956639"
     variation       174
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370536589"
     variation       175
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374241755"
     exon            176..455
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /inference="alignment:Splign:1.39.8"
     variation       190
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201677592"
     variation       195
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148354420"
     variation       200
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371604351"
     variation       229
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73711808"
     variation       247
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200725711"
     variation       285
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145895971"
     variation       286
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138500919"
     variation       292
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61526601"
     variation       344
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150518640"
     variation       359
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202221836"
     variation       397
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73711810"
     variation       403
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114585111"
     variation       436
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367939319"
     exon            456..4735
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /inference="alignment:Splign:1.39.8"
     variation       499
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370616029"
     variation       506
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35938742"
     variation       514
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374293123"
     variation       515
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34279368"
     variation       544
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368398252"
     variation       548
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150347257"
     variation       572
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3739261"
     variation       587
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369316693"
     variation       621
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200845163"
     variation       646
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371947572"
     variation       656
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34665171"
     variation       707
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146812236"
     variation       749
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140629356"
     variation       757
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192420341"
     variation       777
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200836970"
     variation       782
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374163879"
     variation       900
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138013484"
     variation       1010
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:57390041"
     variation       1124
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:142394577"
     variation       1206
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113549310"
     variation       1231
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184580529"
     variation       1348
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:190313906"
     variation       1396
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142461254"
     variation       1499
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2929969"
     variation       1725
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12164193"
     variation       1734
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145960909"
     variation       1740
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:73362554"
     variation       1809
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:182003497"
     variation       1888
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:4265166"
     variation       1939
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2929970"
     variation       2008
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374010309"
     variation       2013
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4577938"
     variation       2104
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377032724"
     variation       2218
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146162433"
     variation       2273
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185849289"
     variation       2569
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188945068"
     variation       2578
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181057409"
     variation       2581
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148796937"
     variation       2802
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:117072299"
     variation       2835
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2977549"
     variation       3138
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:73362557"
     variation       3140
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76779268"
     variation       3174
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2929971"
     variation       3181
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373530385"
     variation       3205
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142427022"
     variation       3257
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2929972"
     variation       3310
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2929973"
     variation       3334
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151300566"
     variation       3482
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:16904856"
     variation       3513..3514
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:36017627"
     variation       3569
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370468302"
     variation       3611
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2977550"
     variation       3726
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9649971"
     variation       3728
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186406622"
     variation       3758
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:16904857"
     variation       3847
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191533905"
     variation       3881
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200715437"
     variation       3909
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145461011"
     variation       4050
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16904858"
     variation       4158
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:114925013"
     variation       4168
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:16904859"
     variation       4224
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:73711826"
     variation       4226..4227
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35647766"
     variation       4231
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:16904860"
     variation       4244..4247
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace=""
                     /replace="ctga"
                     /db_xref="dbSNP:372155216"
     variation       4246..4249
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace=""
                     /replace="gact"
                     /db_xref="dbSNP:367926394"
     variation       4270
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:182511484"
     variation       4287
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186242527"
     variation       4333
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74818902"
     variation       4352
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2977551"
     STS             4417..4583
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /standard_name="RH102883"
                     /db_xref="UniSTS:97217"
     STS             4431..4642
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /standard_name="RH76344"
                     /db_xref="UniSTS:92556"
     variation       4464
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147688784"
     variation       4476
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191950359"
     variation       4641
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77866098"
     polyA_signal    4713..4718
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
     polyA_site      4735
                     /gene="WISP1"
                     /gene_synonym="CCN4; WISP1c; WISP1i; WISP1tc"
ORIGIN      
atatctggtgctcctgatgggccggccagtctgggcccagctcccccgagaggtggtcggatcctctgggctgctcggtcgatgcctgtgccactgacgtccaggcatgaggtggttcctgccctggacgctggcagcagtgacagcagcagccgccagcaccgtcctggccacggccctctctccagcccctacgaccatggactttaccccagctccactggaggacacctcctcacgcccccaattctgcaagtggccatgtgagtgcccgccatccccaccccgctgcccgctgggggtcagcctcatcacagatggctgtgagtgctgtaagatgtgcgctcagcagcttggggacaactgcacggaggctgccatctgtgacccccaccggggcctctactgtgactacagcggggaccgcccgaggtacgcaataggagtgtgtgcacgcagggaagaagtgtctggctgtgtaccagccagaggcatccatgaacttcacacttgcgggctgcatcagcacacgctcctatcaacccaagtactgtggagtttgcatggacaataggtgctgcatcccctacaagtctaagactatcgacgtgtccttccagtgtcctgatgggcttggcttctcccgccaggtcctatggattaatgcctgcttctgtaacctgagctgtaggaatcccaatgacatctttgctgacttggaatcctaccctgacttctcagaaattgccaactaggcaggcacaaatcttgggtcttggggactaacccaatgcctgtgaagcagtcagcccttatggccaataacttttcaccaatgagccttagttaccctgatctggacccttggcctccatttctgtctctaaccattcaaatgacgcctgatggtgctgctcaggcccatgctatgagttttctccttgatatcattcagcatctactctaaagaaaaatgcctgtctctagctgttctggactacacccaagcctgatccagcctttccaagtcactagaagtcctgctggatcttgcctaaatcccaagaaatggaatcaggtagacttttaatatcactaatttcttctttagatgccaaaccacaagactctttgggtccattcagatgaatagatggaatttggaacaatagaataatctattatttggagcctgccaagaggtactgtaatgggtaattctgacgtcagcgcaccaaaactatcctgattccaaatatgtatgcacctcaaggtcatcaaacatttgccaagtgagttgaatagttgcttaattttgatttttaatggaaagttgtatccattaacctgggcattgttgaggttaagtttctcttcacccctacactgtgaagggtacagattaggtttgtcccagtcagaaataaaatttgataaacattcctgttgatgggaaaagcccccagttaatactccagagacagggaaaggtcagcccgtttcagaaggaccaattgactctcacactgaatcagctgctgactggcagggctttgggcagttggccaggctcttccttgaatcttctcccttgtcctgcttggggttcataggaattggtaaggcctctggactggcctgtctggcccctgagagtggtgccctggaacactcctctactcttacagagccttgagagacccagctgcagaccatgccagacccactgaaatgaccaagacaggttcaggtaggggtgtgggtcaaaccaagaagtgggtgcccttggtagcagcctggggtgacctctagagctggaggctgtgggactccaggggcccccgtgttcaggacacatctattgcagagactcatttcacagcctttcgttctgctgaccaaatggccagttttctggtaggaagatggaggtttaccggttgtttagaaacagaaatagacttaataaaggtttaaagctgaagaggttgaagctaaaaggaaaaggttgttgttaatgaatatcaggctattatttattgtattaggaaaatataatatttactgttagaattcttttatttagggccttttctgtgccagacattgctctcagtgctttgcatgtattagctcactgaatcttcacgacaatgttgagaagttcccattattatttctgttcttacaaatgtgaaacggaagctcatagaggtgagaaaactcaaccagagtcacccagttggtgactgggaaagttaggattcagatcgaaattggactgtctttataacccatattttccccctgtttttagagcttccaaatgtgtcagaataggaaaacattgcaataaatggcttgattttttaatgtcatttttccctcttatagtctttctagctccttttcaaaagacgagaatatctgattttctgataatttaggtgcttaagcatccaaaatacatgggacacacaaaaatccaggaatcccctgtagcttattccctctttcccatcggaaccagctctcatcacacatttaaaagatgattctgtttacccaatgctgcatattgaatgttgtgtagttattcacagggaattctgtgcagtgtgcagagagattcctaaacgggaaaaggactgggaatacatcctccttactgtgacctccccaaaacctagtccagtgcaaggtatacagtggtgctcattaaatacttgatgaatacaggaagctgtgcatgtgttcctacttttattcgaagctctcttcttccaaagctacatgaaaatagaattttaacagtcaaaattttatattaagtgccttagcaaaagagacatttaatatttcaaagaaatgcatatgtatgtatacatatatttgtgtatgcgtatgcaagaattcttgtataaagagaattcactccatgaatgatctcttctgtaagtcagtgtgaatcatgttagattttctgagagtgaaaacacctgccatctacaaattacaaggctggataacagctcactccatttgaaattcagtggaaacccaagagctaggttcttactgaatttgcatctcaatttgggaaactgaacttagctttcaaagatcataggaagtctggttggagaaactagggattattctggcaatgggtgcaggaaggtggtcagaataacccagtcgccattggttttgagaaacggaactatcttatgcagagcccggagggcaagtctcagacccatgggttgaagccatggagaaggaaatttggatccaatgtaatgaagcgctttctaagtcagaatttccctgcaatggtgtggcctgattcaataaaaattaagaataataaatataatggaaaaaaatctccactgattgagtgtttacttggtgccaagcactatgctaagttgttcattattttatttaattgttacagcaattttgagtatgcatctttcactattttataagtggaaaagagaagtgcccccaaaaagttagagctcaaacagcagcttattctaccagcccctgctcttgcggaggcctctggaaaagacctgaatgacacctattggagaattacatctacaaggggcttcaaacagaccaaatagatcatcacctctgtggtcccttgttaactatatgttctgagacaaaggaaagctaccctaagggttagttaacctttgctgaggaaatttacattcatacttagagtgaattactcaggtgtgcttaggtgtgcaaaagggaaggagacctgaattcaccaagttaaatcttgctaaaccttatcataagcattttttgagcgcttagcatacaccaagccttgtggaaggtgctttcctgccatatctcatttaatcctcacagcaaacctatagaatatggcattatcatctgagtctcacagaagtttagtcgtgtactcaaggtcttaccagctagtgaacagcagaccaagactggaaacccaggatagtctgatacctgagccatctcttcttgtgctacgcctagttattctgtcccccaaatcaaaaggcatgacctttataagaggcgctttactgacaatagctgcaattttaactttgaaaatgattcagaattatcaaagatagtagattcgaatgacatgattgtctataatctcgctagccttgtactgtgtgtgcatagcaattacagggaagtaatctagctcctgactattatgttgaactatgtcgctgctttttacaaacttgtcttgatccaaagcagtcacaatgataaccctgcatatctgggaatcataagtcaactatgtatccctgtgtgtgtatatatatgtatgtatgtatctattttcaaactgtgatttaatatttaaatattcctactgccatttttgtgactgaaaaactacacatgaggaaacgtcttagaattttccaatagaggaaaaataacacttgggcaatctgtcatgtttcacaacagttctcatttttctcatgatttgtgtagcgtggaatgtgtttgctcaatgtgaagggttttcattgctcaatttctctgtgtaagtcttttccttaaggtaataaaccatcagcaaagtcacatactggagttggtggcttttcttgtacaggcagttgttatgagacaatgatggagcattgagcatgttcaataaatgtgcagatggtggaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:8840 -> Molecular function: GO:0005520 [insulin-like growth factor binding] evidence: IEA
            GeneID:8840 -> Biological process: GO:0001558 [regulation of cell growth] evidence: IEA
            GeneID:8840 -> Biological process: GO:0007155 [cell adhesion] evidence: IEA
            GeneID:8840 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
            GeneID:8840 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
            GeneID:8840 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA
            GeneID:8840 -> Cellular component: GO:0005615 [extracellular space] evidence: NAS
            GeneID:8840 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.