2024-04-26 04:53:22, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001199839 3576 bp mRNA linear PRI 24-JUN-2013 DEFINITION Homo sapiens BCL2-like 2 (BCL2L2), transcript variant 2, mRNA. ACCESSION NM_001199839 VERSION NM_001199839.1 GI:315360667 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3576) AUTHORS Casanelles,E., Gozzelino,R., Marques-Fernandez,F., Iglesias-Guimarais,V., Garcia-Belinchon,M., Sanchez-Osuna,M., Sole,C., Moubarak,R.S., Comella,J.X. and Yuste,V.J. TITLE NF-kappaB activation fails to protect cells to TNFalpha-induced apoptosis in the absence of Bcl-xL, but not Mcl-1, Bcl-2 or Bcl-w JOURNAL Biochim. Biophys. Acta 1833 (5), 1085-1095 (2013) PUBMED 23369735 REMARK GeneRIF: we describe that the specific knockdown of Bcl-xL, but not that of Bcl-2, Bcl-w or Mcl-1, renders cells sensitive to TNFalpha-induced apoptosis. REFERENCE 2 (bases 1 to 3576) AUTHORS Wang,F., Liu,M., Li,X. and Tang,H. TITLE MiR-214 reduces cell survival and enhances cisplatin-induced cytotoxicity via down-regulation of Bcl2l2 in cervical cancer cells JOURNAL FEBS Lett. 587 (5), 488-495 (2013) PUBMED 23337879 REMARK GeneRIF: Expression of miR-214 reduces cell survival, induces apoptosis and enhances sensitivity to cisplatin through directly inhibiting Bcl2l2 expression. REFERENCE 3 (bases 1 to 3576) AUTHORS Guan,Z., Shi,N., Song,Y., Zhang,X., Zhang,M. and Duan,M. TITLE Induction of the cellular microRNA-29c by influenza virus contributes to virus-mediated apoptosis through repression of antiapoptotic factors BCL2L2 JOURNAL Biochem. Biophys. Res. Commun. 425 (3), 662-667 (2012) PUBMED 22850539 REMARK GeneRIF: These findings indicate that miR-29c-mediated BCL2L2 suppression is involved in influenza virus-induced cell death in A549 cells. REFERENCE 4 (bases 1 to 3576) AUTHORS Kim,E.M., Kim,J., Park,J.K., Hwang,S.G., Kim,W.J., Lee,W.J., Kang,S.W. and Um,H.D. TITLE Bcl-w promotes cell invasion by blocking the invasion-suppressing action of Bax JOURNAL Cell. Signal. 24 (6), 1163-1172 (2012) PUBMED 22570867 REMARK GeneRIF: By using human cancer cells and mouse embryonic fibroblasts, the study shows that BCL-W functions in the mitochondria to increase the levels of reactive oxygen species (ROS), which subsequently stimulates the invasion-promoting signaling pathway. REFERENCE 5 (bases 1 to 3576) AUTHORS Guo,W.J., Jin,Z. and Wang,A.Y. TITLE [Expression of Bcl-w protein in human small intestinal adenocarcinoma and effect of Bcl-w siRNA on apoptosis in intestinal adenocarcinoma HuTu-80 cells] JOURNAL Zhonghua Zhong Liu Za Zhi 34 (3), 182-186 (2012) PUBMED 22780970 REMARK GeneRIF: Bcl-w protein plays a significant role in the carcinogenesis of human small intestinal adenocarcinoma. Down-regulation of Bcl-w protein in HuTu-80 cells makes them susceptible to 5-Fu. REFERENCE 6 (bases 1 to 3576) AUTHORS Middleton,G., Wyatt,S., Ninkina,N. and Davies,A.M. TITLE Reciprocal developmental changes in the roles of Bcl-w and Bcl-x(L) in regulating sensory neuron survival JOURNAL Development 128 (3), 447-457 (2001) PUBMED 11152643 REFERENCE 7 (bases 1 to 3576) AUTHORS Hsu,S.Y., Lin,P. and Hsueh,A.J. TITLE BOD (Bcl-2-related ovarian death gene) is an ovarian BH3 domain-containing proapoptotic Bcl-2 protein capable of dimerization with diverse antiapoptotic Bcl-2 members JOURNAL Mol. Endocrinol. 12 (9), 1432-1440 (1998) PUBMED 9731710 REFERENCE 8 (bases 1 to 3576) AUTHORS Ross,A.J., Waymire,K.G., Moss,J.E., Parlow,A.F., Skinner,M.K., Russell,L.D. and MacGregor,G.R. TITLE Testicular degeneration in Bclw-deficient mice JOURNAL Nat. Genet. 18 (3), 251-256 (1998) PUBMED 9500547 REFERENCE 9 (bases 1 to 3576) AUTHORS O'Connor,L., Strasser,A., O'Reilly,L.A., Hausmann,G., Adams,J.M., Cory,S. and Huang,D.C. TITLE Bim: a novel member of the Bcl-2 family that promotes apoptosis JOURNAL EMBO J. 17 (2), 384-395 (1998) PUBMED 9430630 REFERENCE 10 (bases 1 to 3576) AUTHORS Gibson,L., Holmgreen,S.P., Huang,D.C., Bernard,O., Copeland,N.G., Jenkins,N.A., Sutherland,G.R., Baker,E., Adams,J.M. and Cory,S. TITLE bcl-w, a novel member of the bcl-2 family, promotes cell survival JOURNAL Oncogene 13 (4), 665-675 (1996) PUBMED 8761287 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA288957.1, DA451936.1, BC104789.1, BQ359913.1, AL049829.4 and BQ001111.1. Summary: This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. [provided by RefSeq, Dec 2010]. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Both variants 1 and 2 encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: DA451936.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-44 DA288957.1 1-44 45-215 DA451936.1 1-171 216-1289 BC104789.1 197-1270 1290-1378 BQ359913.1 185-273 1379-3036 AL049829.4 91636-93293 3037-3576 BQ001111.1 1-540 c FEATURES Location/Qualifiers source 1..3576 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q11.2-q12" gene 1..3576 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="BCL2-like 2" /db_xref="GeneID:599" /db_xref="HGNC:995" /db_xref="MIM:601931" exon 1..88 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /inference="alignment:Splign:1.39.8" STS 29..350 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /standard_name="MARC_5753-5754:996690790:1" /db_xref="UniSTS:269559" exon 89..176 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /inference="alignment:Splign:1.39.8" variation 130 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:377264616" misc_feature 155..157 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="upstream in-frame stop codon" exon 177..616 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /inference="alignment:Splign:1.39.8" variation 178 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:181554850" variation 179 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:375706345" CDS 185..766 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51" /codon_start=1 /product="bcl-2-like protein 2" /protein_id="NP_001186768.1" /db_xref="GI:315360668" /db_xref="CCDS:CCDS9591.1" /db_xref="GeneID:599" /db_xref="HGNC:995" /db_xref="MIM:601931" /translation="
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
" misc_feature 209..625 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="Apoptosis regulator proteins of the Bcl-2 family, named after B-cell lymphoma 2. This alignment model spans what have been described as Bcl-2 homology regions BH1, BH2, BH3, and BH4. Many members of this family have an additional C-terminal transmembrane...; Region: Bcl-2_like; cd06845" /db_xref="CDD:132900" misc_feature 209..271 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q92843.2); Region: BH4" misc_feature 209..247 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="BH4; other site" /db_xref="CDD:132900" misc_feature <308..664 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="apoptosis regulator; Region: bcl-2; TIGR00865" /db_xref="CDD:233158" misc_feature 320..346 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="BH3; other site" /db_xref="CDD:132900" misc_feature order(329..334,338..343,353..355,362..367,413..418, 425..430,437..442,458..460,464..469,473..478,488..490, 500..502) /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="BH3-homology region binding site; other site" /db_xref="CDD:132900" misc_feature 437..496 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q92843.2); Region: BH1" misc_feature order(437..445,455..493) /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="BH1; other site" /db_xref="CDD:132900" misc_feature 590..637 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q92843.2); Region: BH2" misc_feature 590..625 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /note="BH2; other site" /db_xref="CDD:132900" variation 205 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:145819636" variation 289 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:2231300" variation 292 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:140247035" variation 306 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="g" /db_xref="dbSNP:372286720" variation 307 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:2231301" variation 312 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:137944195" variation 325 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:374687458" variation 359 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:377103042" variation 360 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:372109088" variation 379 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:369139282" variation 412 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:1049463" variation 416 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:143454020" variation 433 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="c" /db_xref="dbSNP:373000086" variation 436 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:1049465" variation 450 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:144907357" variation 481 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:376965445" variation 526 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:34019986" variation 580 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:148533206" variation 582..585 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="" /replace="agct" /db_xref="dbSNP:200485369" variation 582 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:910332" variation 606 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:201407690" exon 617..3560 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /inference="alignment:Splign:1.39.8" variation 637 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:368889929" variation 638 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:189909787" variation 643 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:373089207" variation 666 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:200041771" variation 716 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:41317322" variation 739 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:371070231" variation 781 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:374244495" variation 790 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:2231302" variation 816 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="g" /db_xref="dbSNP:200109175" variation 826 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:180861464" variation 987 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:114093099" variation 1000 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="g" /replace="t" /db_xref="dbSNP:28727519" variation 1010 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="" /replace="g" /db_xref="dbSNP:11286673" variation 1034 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:186099381" variation 1174 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:190956287" variation 1256 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="g" /replace="t" /db_xref="dbSNP:59528193" variation 1290 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:1950252" variation 1313 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="t" /db_xref="dbSNP:111480091" variation 1383 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:368751711" variation 1400 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:369662743" variation 1403 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="g" /db_xref="dbSNP:117138993" variation 1532 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:59634591" variation 1557 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:147292152" variation 1697 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="g" /replace="t" /db_xref="dbSNP:141040681" variation 1739 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:149848377" variation 2041 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:183322615" variation 2078 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="g" /replace="t" /db_xref="dbSNP:2076680" variation 2094 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="t" /db_xref="dbSNP:144693557" variation 2226 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="g" /db_xref="dbSNP:1535094" variation 2259 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="t" /db_xref="dbSNP:188775826" variation 2297 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:79730308" variation 2464 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:191138928" variation 2469 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="c" /db_xref="dbSNP:3210043" variation 2532 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="g" /replace="t" /db_xref="dbSNP:78478800" variation 2565 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:112933062" variation 2623 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:183445900" STS 2665..3561 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /standard_name="BCL2L2_718" /db_xref="UniSTS:277027" variation 2724 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:187184653" variation 2739 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="g" /db_xref="dbSNP:112390836" variation 2814 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:10149339" variation 2929..2930 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="" /replace="gg" /db_xref="dbSNP:142850799" variation 2931 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="g" /replace="t" /db_xref="dbSNP:374168548" variation 3163 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="" /replace="ta" /db_xref="dbSNP:56889032" variation 3257 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:45519738" variation 3300 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="a" /replace="g" /db_xref="dbSNP:191254635" STS 3323..3551 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /standard_name="RH75103" /db_xref="UniSTS:91127" variation 3335 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:1049485" variation 3371 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:183840707" variation 3378 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /replace="c" /replace="t" /db_xref="dbSNP:142892590" STS 3379..3549 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" /standard_name="EST16D6" /db_xref="UniSTS:263142" polyA_signal 3514..3519 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" polyA_signal 3523..3528 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" polyA_signal 3527..3532 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" polyA_site 3546 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" polyA_site 3549 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" polyA_site 3552 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" polyA_site 3560 /gene="BCL2L2" /gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51" ORIGIN
aggaaacggcccggatcccggcagcggcctgacccgtgagatccctaacctggcaggcgggcggggttggagactggctgaggtggggggctccacgctggccaggaggatgaaaggccccagctgggggctccttgccaccagtgctgtgtcttaagagctgccatcccggctggccgcccggatggcgaccccagcctcggccccagacacacgggctctggtggcagactttgtaggttataagctgaggcagaagggttatgtctgtggagctggccccggggagggcccagcagctgacccgctgcaccaagccatgcgggcagctggagatgagttcgagacccgcttccggcgcaccttctctgatctggcggctcagctgcatgtgaccccaggctcagcccaacaacgcttcacccaggtctccgatgaactttttcaagggggccccaactggggccgccttgtagccttctttgtctttggggctgcactgtgtgctgagagtgtcaacaaggagatggaaccactggtgggacaagtgcaggagtggatggtggcctacctggagacgcggctggctgactggatccacagcagtgggggctgggcggagttcacagctctatacggggacggggccctggaggaggcgcggcgtctgcgggaggggaactgggcatcagtgaggacagtgctgacgggggccgtggcactgggggccctggtaactgtaggggccttttttgctagcaagtgaaagtccagggccaggtggggctaggtgtggctgggggccaggagagcaggaacagaacagagaaatgcccttggaagaagtggagttggtggatgggtgggcatggaacaggatgggcagagaaagggtagtgtgtgagggagctgagtaggccaggtaggcgattggaagagtgagcaggacacagaggggaggggaatgttttggcaagtttaggggcacaggagatgtagtcgttccagggctgggggaggtgggagggatcacgcctataggtgtgggcacatgaaacgacctggaacttgcttcacagccctgaggaaggtggacttacataagcagctgtattccattagatgagtgggatttagggaacgcagaaggcacatccctttggaatggaagcttaggggttctcaggtgatagggagaggtggctgttaacagtgggctgcttggacacgcgtgtgcatgtgcacgcatgctggtgtgcatgctgggctgcctggcaaatctggtggtgatgggattcctcaaggagaaaacattccctcttgcaatggcaagaactaggggcagttctctgtccctcctcccaacccctcctttcccctgcccttgtcctgatgcctcaaggcttagagagaaacattgtatccagaccgagggctctgctgcttctttccagaaagtgattggcaaggctttggagagaagagcagttctgcagctggccttgttccttcatcatcccccttccttgtgcattatgcacttgctgctgcctcctgggctctgatagaagggcagggctgttgagcctggatgggtggaggcttaggtagccggacctgcctgccaccctcctctcccactcaggcacaatggtgcctaaagtgtttccaatctctgggacctctgtacccaaactgaaactctaaattggggccctaactaattttccttttgaggttgtgggcataagtgctgatctagaatacagtctgggtcccacactgtgtctcagtgagactgttgatgccttgagatgaccatttcagatctgaatcccatgggtgtgagggtgatgggtactccaggactggcctatgctgtgttgtgggctttggttcggctttatcaggggccaggcatatgggttctagagtacctaccatgacctagaagcatttatgatttatttgaagccacactgtttgcatgggtgttacttgtctgtacctcagagtctgaggatgttaactttggaactcgcagtcctctagaacagcttcagattatggctttttcttttgaggaagaaattattcactccagatgcatgccctgagccagacctcactgctgcactttccaaggtgctaagattgctgctctccaatgctaactttctgacacagtgctctagaaccctgcctgtggtcctgagcactgatcaccttagctagaccatggttgactcttcttggagattttcacttggtcctagaatgtggcaacgtagttgtgctcgccagaacgtgggaccaaattggcctcaggtgttgagtccagacttctgcttttgagagagggctgcactttttcatggtatttctaggggaggtggtaggctgcatgtgccacttggtcttgttgtgagtatgctgacaccagaaactcagagccagcttgtggcaagcagttggggtggggggtctctgacttgctcaggacaaactaggccagtggttttcaaactgcttggcagagccctgaagtttcctaggggttgcctcaggagtccttggggagatgaagggggtggggagctgagcaggctgggcaatttgccctcaaacagaacagctccccttgtagctgtcttacatattggggttcagggtaagattttatttgcattaaggggtttgctgctgaaaaaaagttggaaaaccactgactagaccatcggctccaaattggagtctgtgcttccttccccaggtatggagcacactcttcaccctaccctctaccacaggacacatatccctgttagcattccccgggacctttagccaagaggagctgcagggaccatggccaggttaccaaaatgccctgctctgaagccttgacacctgggtggaaagagaggctgttttctgaaagggtaaagggcttggtctggattcccagaagcatagcttagatgggaccacagtgggcaattttgacctgtcctgcccttcttagcttgaagggaaaccccagagactcttctgtcagggaaaactagggactctcttctagagccatatagttccttgggattagctcttggccaagaaggctgagtatggttcccaatttttaaatccatttcattttttaaaaaataagggaaataaatgtaattgccatttttcaaagattaagtaggaggagaggggtttcttgctctccagagcccaaagggacaaatagggactttgtttaggccaaggaaggagcggaagtagggcaactcggtcctgcgattattaatcccactccccacttattctagggcacacaaacactattttacttttttaaaatcataaaacggcagaacagatttggttagtttagaagaaaagaaagctctataaatataaatctatattcctgtatttttatttaataatttataaataccaagttcatttgacttttatttttgtgtaatatgtaatgatcgtattaaaaacaataaataaagcccagaagtttaatgagaaggactgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:599 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:599 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:599 -> Biological process: GO:0007283 [spermatogenesis] evidence: TAS GeneID:599 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IMP GeneID:599 -> Biological process: GO:0060011 [Sertoli cell proliferation] evidence: IEA GeneID:599 -> Cellular component: GO:0005829 [cytosol] evidence: IEA GeneID:599 -> Cellular component: GO:0031966 [mitochondrial membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.