Home |
Help |
Advanced search
2024-04-18 16:52:12, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001199535 1090 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens TGIF2-C20orf24 readthrough (TGIF2-C20orf24), mRNA.
ACCESSION NM_001199535
VERSION NM_001199535.1 GI:313747554
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1090)
AUTHORS Prakash,T., Sharma,V.K., Adati,N., Ozawa,R., Kumar,N., Nishida,Y.,
Fujikake,T., Takeda,T. and Taylor,T.D.
TITLE Expression of conjoined genes: another mechanism for gene
regulation in eukaryotes
JOURNAL PLoS ONE 5 (10), E13284 (2010)
PUBMED 20967262
REMARK Publication Status: Online-Only
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL050318.13.
Summary: This locus represents naturally occurring read-through
transcription between the neighboring TGIF2 (TGFB-induced factor
homeobox 2) and C20orf24 (chromosome 20 open reading frame 24)
genes. The read-through transcript encodes a fusion protein that
shares sequence identity with each individual gene product.
[provided by RefSeq, Dec 2010].
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
##Evidence-Data-START##
Transcript exon combination :: BX377269.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025085 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
readthrough transcript :: includes exons from GeneID 55969, 60436
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-82 AL050318.13 85272-85353
83-308 AL050318.13 89459-89684
309-412 AL050318.13 118433-118536
413-542 AL050318.13 120319-120448
543-1090 AL050318.13 122728-123275
FEATURES Location/Qualifiers
source 1..1090
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="20"
/map="20q"
gene 1..1090
/gene="TGIF2-C20orf24"
/note="TGIF2-C20orf24 readthrough"
/db_xref="GeneID:100527943"
/db_xref="HGNC:44664"
exon 1..82
/gene="TGIF2-C20orf24"
/inference="alignment:Splign:1.39.8"
exon 83..308
/gene="TGIF2-C20orf24"
/inference="alignment:Splign:1.39.8"
variation 89
/gene="TGIF2-C20orf24"
/replace="c"
/replace="g"
/db_xref="dbSNP:374969064"
variation 96
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:368026783"
misc_feature 102..104
/gene="TGIF2-C20orf24"
/note="upstream in-frame stop codon"
CDS 117..584
/gene="TGIF2-C20orf24"
/codon_start=1
/product="TGIF2-C20orf24 protein"
/protein_id="NP_001186464.1"
/db_xref="GI:313747555"
/db_xref="CCDS:CCDS58772.1"
/db_xref="GeneID:100527943"
/db_xref="HGNC:44664"
/translation="
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIHYD
"
misc_feature 171..>338
/gene="TGIF2-C20orf24"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cd00086"
/db_xref="CDD:238039"
misc_feature order(171..185,189..191,249..251,267..269,306..308,
327..332)
/gene="TGIF2-C20orf24"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238039"
misc_feature order(177..179,186..188,330..332)
/gene="TGIF2-C20orf24"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:238039"
misc_feature 321..563
/gene="TGIF2-C20orf24"
/note="Rab5-interacting protein (Rab5ip); Region: Rab5ip;
pfam07019"
/db_xref="CDD:148567"
variation 143
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:370918031"
variation 152
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:373991636"
variation 163
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:371719080"
variation 203
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:142209425"
variation 231
/gene="TGIF2-C20orf24"
/replace="g"
/replace="t"
/db_xref="dbSNP:147784268"
variation 239
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:6028205"
variation 244
/gene="TGIF2-C20orf24"
/replace="a"
/replace="t"
/db_xref="dbSNP:368202205"
variation 247
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:371990676"
variation 266
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:375356918"
variation 292
/gene="TGIF2-C20orf24"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:200411969"
exon 309..412
/gene="TGIF2-C20orf24"
/inference="alignment:Splign:1.39.8"
variation 331
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:200467555"
variation 359
/gene="TGIF2-C20orf24"
/replace="a"
/replace="c"
/db_xref="dbSNP:145335248"
variation 379
/gene="TGIF2-C20orf24"
/replace="g"
/replace="t"
/db_xref="dbSNP:199502068"
exon 413..542
/gene="TGIF2-C20orf24"
/inference="alignment:Splign:1.39.8"
variation 444
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:374405285"
variation 487
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:368627271"
variation 493
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:149230426"
exon 543..1090
/gene="TGIF2-C20orf24"
/inference="alignment:Splign:1.39.8"
variation 553
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:138244240"
variation 589
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:145156759"
variation 593
/gene="TGIF2-C20orf24"
/replace="a"
/replace="t"
/db_xref="dbSNP:369227155"
variation 616
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:372092965"
variation 623
/gene="TGIF2-C20orf24"
/replace="c"
/replace="g"
/db_xref="dbSNP:138992970"
variation 636
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:143917410"
variation 643
/gene="TGIF2-C20orf24"
/replace="c"
/replace="g"
/db_xref="dbSNP:200804664"
variation 655
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:190742083"
variation 670
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:140513057"
variation 683
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:375889787"
variation 687
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:2232911"
variation 690
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:202088044"
variation 692
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:138333574"
variation 705
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:367602721"
variation 706
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:200128148"
variation 708
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:141883588"
variation 709
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:376043012"
STS 716..997
/gene="TGIF2-C20orf24"
/standard_name="WI-19258"
/db_xref="UniSTS:75642"
STS 716..883
/gene="TGIF2-C20orf24"
/standard_name="D20S1010"
/db_xref="UniSTS:47881"
variation 741
/gene="TGIF2-C20orf24"
/replace="a"
/replace="t"
/db_xref="dbSNP:150570188"
variation 743
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:6028360"
variation 794
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:1060320"
STS 799..956
/gene="TGIF2-C20orf24"
/standard_name="HUM000AA21"
/db_xref="UniSTS:81340"
variation 814
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:111270662"
variation 952..953
/gene="TGIF2-C20orf24"
/replace=""
/replace="atc"
/db_xref="dbSNP:142502467"
variation 967
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:182263194"
variation 982
/gene="TGIF2-C20orf24"
/replace="c"
/replace="t"
/db_xref="dbSNP:11540276"
variation 984
/gene="TGIF2-C20orf24"
/replace="a"
/replace="g"
/db_xref="dbSNP:376471373"
variation 1033
/gene="TGIF2-C20orf24"
/replace="c"
/replace="g"
/db_xref="dbSNP:11643"
variation 1058
/gene="TGIF2-C20orf24"
/replace="c"
/replace="g"
/db_xref="dbSNP:7870"
ORIGIN
cccgcgccccgaagagtcggccagccccgaactgccggagtaggggtgggaaccaaactttttcctgccccgggacagacacgtttacccaaggtccagcctagcccctaggcaccatgtcggacagtgatctaggtgaggacgaaggcctcctctccctggcgggcaaaaggaagcgcagggggaacctgcccaaggagtcggtgaagatcctccgggactggctgtacttgcaccgctacaacgcctacccctcagagcaggagaagctgagcctttctggacagaccaacctgtcagtgctgcaagatgaatttttagatgtgatctactggttccgacagatcattgctgtggtcctgggtgtcatttggggagttttgccattacgagggttcttgggaatagcaggattctgcctgatcaatgcaggagtcctgtacctctacttcagcaattacctacagattgatgaggaagaatatggtggcacgtgggagctcacgaaggaagggtttatgacctcttttgccttgttcatggtcatttggatcatcttttacactgccatccattatgactgatggtgtacagctcccaagtgctccctatccagtccaaaggaccctcttgattacagcacaggaacttgatcgttggggaaccccagccccttggaacttggaagacccgtgtttcctggaccgcgaatcagtgtgttgggcatcagtgttttctgcaagggttgtgacctgaaactttttaaaaaccacccacctttggggaagcatttctgaatttatccatcaccaaccatttcttcttggataccatcaagtaacagctattatttgccaagtggagctgtcatttaatttgatgcacctctggattcagatgaaacattaaattgtcttcctcgattctccatcgggtgtagagtttttaaactatcaatggcatttcaagtcttctgaaacagcatggctgtatgtgcgtggtccatagcacagtacatgcagcatctaataagagtttccattgtagaatgttttcacatacttgaataaatcaaatctttaattgagaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.