GGRNA Home | Help | Advanced search

2020-10-24 06:55:16, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001199233             731 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens uncharacterized LOC100505478 (LOC100505478), mRNA.
ACCESSION   NM_001199233 XM_001715082 XM_001717108 XM_001718491 XM_003118615
            XM_003118616 XM_003120101 XM_003120102 XM_003120643 XM_003120644
VERSION     NM_001199233.1  GI:312839861
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 731)
  AUTHORS   Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R.
  TITLE     Personalized smoking cessation: interactions between nicotine dose,
            dependence and quit-success genotype score
  JOURNAL   Mol. Med. 16 (7-8), 247-253 (2010)
   PUBMED   20379614
  REMARK    GeneRIF: Clinical trial of gene-disease association and
            gene-environment interaction. (HuGE Navigator)
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB456645.1, DB452574.1 and AA976029.1.
            On or before Nov 28, 2010 this sequence version replaced
            gi:310116613, gi:310116615, gi:169181279, gi:310128999,
            gi:310129001, gi:239755118, gi:310120397, gi:310120399,
            gi:169179390.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DB452574.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025084, ERS025085 [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-38                DB456645.1         1-38
            39-258              DB452574.1         1-220
            259-551             DB456645.1         213-505
            552-731             AA976029.1         1-180               c
FEATURES             Location/Qualifiers
     source          1..731
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9q32"
     gene            1..731
                     /gene="LOC100505478"
                     /note="uncharacterized LOC100505478"
                     /db_xref="GeneID:100505478"
     exon            1..55
                     /gene="LOC100505478"
                     /inference="alignment:Splign:1.39.8"
     exon            56..163
                     /gene="LOC100505478"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    139..141
                     /gene="LOC100505478"
                     /note="upstream in-frame stop codon"
     CDS             160..522
                     /gene="LOC100505478"
                     /codon_start=1
                     /product="uncharacterized protein LOC100505478"
                     /protein_id="NP_001186162.1"
                     /db_xref="GI:312839862"
                     /db_xref="GeneID:100505478"
                     /translation="
MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP
"
     exon            164..286
                     /gene="LOC100505478"
                     /inference="alignment:Splign:1.39.8"
     exon            287..418
                     /gene="LOC100505478"
                     /inference="alignment:Splign:1.39.8"
     variation       293
                     /gene="LOC100505478"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1359992"
     exon            419..731
                     /gene="LOC100505478"
                     /inference="alignment:Splign:1.39.8"
     variation       485
                     /gene="LOC100505478"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1055207"
ORIGIN      
gttccccagctctgtgacatcacagacagccttctgtctactctgccagctgcaggaaacagcccagcccagtgaactgggctcaaactcaagactggctgattcaacaaggcacccctgcagacaaagctggcagagtagaagtttcaactcctttccatggcagcccaccaaaacctgatcttgaagatcttctgtttatgctgcagggactgtcaggagccctatgccatcaatgactccaaggttcccagtcaaacccaggagcacaagccatcgacccaaaatttgctgcttcagaaggatgagcttgacagacaaaatcccaagcgcattaacgcagtctcccatttgccttcgagaacacccctgatccagacaaaaaagagcacttcctccagcagcagtgagtttgaggatctgaatgcatatgcttcccaaagaaatttttacaagagaaacttaaaccgctactgccaggagcactggccattccagccatgcctcactgggaggccctgagcattctagccggcggctgcacagctgctggggcatctccatgaggaagagggcggtggacaggagtcatgaagactaattcggaaactcccctgaaggaggagaagacatctgagccatccttgtgccaccaagcaagagtcactccagctcctaaaaagccaccatgggaagagctgcctccaattaaagttcttgattgcaccaga
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.