GGRNA Home | Help | Advanced search

2019-03-23 03:57:35, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001199104            2982 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens NT5C1B-RDH14 readthrough (NT5C1B-RDH14), transcript
            variant 2, mRNA.
ACCESSION   NM_001199104
VERSION     NM_001199104.1  GI:312283683
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2982)
  AUTHORS   Prakash,T., Sharma,V.K., Adati,N., Ozawa,R., Kumar,N., Nishida,Y.,
            Fujikake,T., Takeda,T. and Taylor,T.D.
  TITLE     Expression of conjoined genes: another mechanism for gene
            regulation in eukaryotes
  JOURNAL   PLoS ONE 5 (10), E13284 (2010)
   PUBMED   20967262
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC079148.9 and AK057444.1.
            
            Summary: This locus represents naturally occurring read-through
            transcription between the neighboring NT5C1B (5'-nucleotidase,
            cytosolic IB) and RDH14 (retinol dehydrogenase 14) genes on
            chromosome 2. Alternative splicing results in multiple transcript
            variants, one of which encodes a fusion protein that shares
            sequence identity with the products of each individual gene.
            [provided by RefSeq, Nov 2010].
            
            Transcript Variant: This variant (2) includes an additional
            in-frame exon in the 5' coding region, an alternate in-frame splice
            site in the central coding region, and an additional exon that
            causes a frameshift in the 3' coding region, compared to variant 1.
            The encoded isoform (2) is shorter and has a distinct C-terminus,
            and it lacks sequence identity with the RDH14 product, compared to
            isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK057444.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025084, ERS025085 [ECO:0000350]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            readthrough transcript :: includes exons from GeneID 57665, 93034
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-18                AC079148.9         144226-144243       c
            19-2160             AK057444.1         1-2142
            2161-2982           AC079148.9         109386-110207       c
FEATURES             Location/Qualifiers
     source          1..2982
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p"
     gene            1..2982
                     /gene="NT5C1B-RDH14"
                     /note="NT5C1B-RDH14 readthrough"
                     /db_xref="GeneID:100526794"
                     /db_xref="HGNC:38831"
     exon            1..142
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    8..10
                     /gene="NT5C1B-RDH14"
                     /note="upstream in-frame stop codon"
     variation       complement(92)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368657100"
     variation       complement(93)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375020758"
     variation       complement(102)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370091625"
     CDS             113..1921
                     /gene="NT5C1B-RDH14"
                     /note="isoform 2 is encoded by transcript variant 2;
                     NT5C1B-RDH14 read-through transcript"
                     /codon_start=1
                     /product="NT5C1B-RDH14 protein isoform 2"
                     /protein_id="NP_001186033.1"
                     /db_xref="GI:312283684"
                     /db_xref="CCDS:CCDS56111.1"
                     /db_xref="GeneID:100526794"
                     /db_xref="HGNC:38831"
                     /translation="
MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQGQQITMMRGSQESSLRKTDSRGYLVRSQWSRISRSPSTKAPSIDEPRSRNTSAKLPSSSTSSRTPSTSPSLHDSSPPPLSGQPSLQPPASPQLPRSLDSRPPTPPEPDPGSRRSTKMQENPEAWAQGIVREIRQTRDSQPLEYSRTSPTEWKSSSQRRGIYPASTQLDRNSLSEQQQQQREDEDDYEAAYWASMRSFYEKNPSCSRPWPPKPKNAITIALSSCALFNMVDGRKIYEQEGLEKYMEYQLTNENVILTPGPAFRFVKALQYVNARLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKDPIGYLKAYLTNLYIAADSEKVQEAIQEGIASATMFDGAKDMAYCDTQLRVAFDGDAVLFSDESEHFTKEHGLDKFFQYDTLCESKPLAQGPLKGFLEDLGRLQKKFYAKNERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEIDEALFLAGAPKSPILVKIRPHIFFDDHMFHIEGAQRKSLGWMS
"
     misc_feature    1121..1897
                     /gene="NT5C1B-RDH14"
                     /note="5'-nucleotidase; Region: 5-nucleotidase; pfam06189"
                     /db_xref="CDD:148034"
     variation       complement(133)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17852342"
     exon            143..232
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(148)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139661780"
     variation       complement(151)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16985306"
     variation       complement(152)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150854562"
     variation       complement(173)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142250232"
     variation       complement(178)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373948064"
     variation       complement(219)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368786487"
     exon            233..412
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(240)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144387028"
     variation       complement(251)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140803100"
     variation       complement(259)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369042120"
     variation       complement(261)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373286312"
     variation       complement(262)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76041976"
     variation       complement(271)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3810839"
     variation       complement(292)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200114668"
     variation       complement(302)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199544140"
     variation       complement(313)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376548938"
     variation       complement(324)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367989070"
     variation       complement(353)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113913452"
     variation       complement(354)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150116798"
     variation       complement(361)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369072062"
     variation       complement(368)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376686535"
     variation       complement(371)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373559057"
     exon            413..550
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(421)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147993928"
     variation       complement(431)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201679289"
     variation       complement(432)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147855918"
     variation       complement(434)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375353460"
     variation       complement(435)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142174343"
     variation       complement(449)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114622083"
     variation       complement(450)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199873248"
     variation       complement(461)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200122449"
     variation       complement(462)
                     /gene="NT5C1B-RDH14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371760155"
     variation       complement(465)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367871143"
     variation       complement(489)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202225134"
     variation       complement(502)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371117462"
     variation       complement(509)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368550960"
     variation       complement(518)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201205997"
     variation       complement(525)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200286986"
     exon            551..1015
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(589)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61741495"
     variation       complement(604)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117298882"
     variation       complement(622)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200689028"
     variation       complement(639)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61742596"
     variation       complement(672)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61742608"
     variation       complement(687)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368950263"
     variation       complement(764)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369345171"
     variation       complement(769)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200514864"
     variation       complement(794)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373347393"
     variation       complement(795)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150624428"
     variation       complement(807)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369846764"
     variation       complement(808)
                     /gene="NT5C1B-RDH14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200273135"
     variation       complement(811)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144486690"
     variation       complement(825)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201047201"
     variation       complement(861)
                     /gene="NT5C1B-RDH14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76782074"
     variation       complement(880)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377296218"
     variation       complement(887)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202208251"
     variation       complement(900)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146399000"
     variation       complement(924..926)
                     /gene="NT5C1B-RDH14"
                     /replace=""
                     /replace="agc"
                     /db_xref="dbSNP:145060005"
     variation       complement(929)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200906490"
     variation       complement(934)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:191446499"
     variation       complement(950)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199965310"
     variation       complement(977)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113101936"
     variation       complement(994..995)
                     /gene="NT5C1B-RDH14"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34127788"
     variation       complement(994)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372417853"
     exon            1016..1183
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1084)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151116969"
     variation       complement(1088)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370362544"
     variation       complement(1093)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376326986"
     variation       complement(1109)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372553926"
     variation       complement(1123)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:16985301"
     variation       complement(1127)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138883415"
     variation       complement(1139)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140827083"
     variation       complement(1168)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145994780"
     exon            1184..1313
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1211)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113497432"
     variation       complement(1248)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369708621"
     variation       complement(1264)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145263582"
     variation       complement(1286)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183534911"
     variation       complement(1301)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144184703"
     variation       complement(1312)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148193506"
     exon            1314..1436
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1319)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150673884"
     variation       complement(1328)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148419532"
     variation       complement(1329)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142671746"
     variation       complement(1333)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146130311"
     variation       complement(1335)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149545160"
     variation       complement(1342)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140315086"
     variation       complement(1343)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145698850"
     variation       complement(1390)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140510680"
     variation       complement(1406)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148789216"
     variation       complement(1418)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145414794"
     exon            1437..1621
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1477)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373568974"
     variation       complement(1496)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117487981"
     variation       complement(1500)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201567504"
     variation       complement(1511)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368221092"
     variation       complement(1538)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147377645"
     variation       complement(1547)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140280643"
     variation       complement(1570)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3902946"
     variation       complement(1575)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149286164"
     variation       complement(1609)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369771689"
     exon            1622..1896
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1666)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147103410"
     variation       complement(1667)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:79178256"
     variation       complement(1687)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376888692"
     variation       complement(1688)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201315955"
     variation       complement(1691)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112808478"
     variation       complement(1773)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147855687"
     variation       complement(1779)
                     /gene="NT5C1B-RDH14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200342649"
     variation       complement(1788)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146822895"
     variation       complement(1789)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201665017"
     variation       complement(1793)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140939592"
     variation       complement(1794)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144165826"
     variation       complement(1832)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374183150"
     variation       complement(1852)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:202025887"
     variation       complement(1864)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142999822"
     variation       complement(1881)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147939092"
     exon            1897..2982
                     /gene="NT5C1B-RDH14"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1978)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375822735"
     variation       complement(2021)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149867802"
     variation       complement(2030)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141384613"
     variation       complement(2065)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377520259"
     variation       complement(2094)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138658701"
     variation       complement(2095)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201424633"
     variation       complement(2136)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373055751"
     variation       complement(2138)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:138843648"
     variation       complement(2161)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201455737"
     STS             2166..2973
                     /gene="NT5C1B-RDH14"
                     /standard_name="RDH14__5475"
                     /db_xref="UniSTS:463857"
     variation       complement(2193)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:185675117"
     variation       complement(2197)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373938743"
     variation       complement(2200)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143289874"
     variation       complement(2204)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201623319"
     variation       complement(2224)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:138173772"
     variation       complement(2231)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141886106"
     variation       complement(2252)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141569821"
     variation       complement(2265)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142589700"
     variation       complement(2284)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199868568"
     variation       complement(2295)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371846340"
     variation       complement(2297)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200669704"
     variation       complement(2300)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144461545"
     variation       complement(2302)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139953107"
     variation       complement(2309)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201317560"
     variation       complement(2313)
                     /gene="NT5C1B-RDH14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199674055"
     variation       complement(2341)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74378191"
     variation       complement(2358)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:72775091"
     variation       complement(2407)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200234641"
     variation       complement(2449)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368455068"
     variation       complement(2465)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373588347"
     variation       complement(2533)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201282431"
     variation       complement(2536)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376900863"
     variation       complement(2549)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375620361"
     variation       complement(2553)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370947814"
     variation       complement(2579)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148385113"
     variation       complement(2601)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375607315"
     variation       complement(2707)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:115362218"
     variation       complement(2767)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111233807"
     STS             2782..2919
                     /gene="NT5C1B-RDH14"
                     /standard_name="RH102895"
                     /db_xref="UniSTS:97229"
     variation       complement(2805)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190845828"
     variation       complement(2838)
                     /gene="NT5C1B-RDH14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367551928"
     variation       complement(2933)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186442746"
     variation       complement(2976)
                     /gene="NT5C1B-RDH14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:180786126"
ORIGIN      
ataaatttgacattctaaatgcaaagctagactgagcaagggaagtgacaggaaatggagctggggagacaaaaatgtggataacaacaaaagaatttcaacaggtaaaaaaatgagtcaaacatctctcaaacagaaaaagaatgagcctggaatgaggtcctcaaaagagagtctagaagcagaaaaaagaaaggaatctgacaaaacaggagttcgtctgagcaatcagatgaggcgtgcagtcaatccgaatcactcgctgagatgttgccccttccagggtcactcgtcgtgtagacgctgcctttgtgcagctgagggaacagcccttggcccctgccacacaatacgtatttatattcacatgtgcctgttgtgggagcagggccagcagatcaccatgatgaggggatcacaagaatcatcactgcggaagacagactctcgagggtaccttgtgcgcagtcaatggtctagaatatcccggagcccatccaccaaggctccatccatagatgagcctagaagcaggaacaccagtgctaagctccccagcagctccacgagctcccggactccatccacctccccaagcctgcatgactcctcaccgccgccgctgtccgggcagccctcgctccagccacccgcgtcgccccagctgccccggtcgctggactcgcggcctcccacgcccccagagcccgatcctggctcccggcgcagcaccaaaatgcaagagaatccggaggcctgggcccaaggcatcgtgcgggaaatccgccagacccgggactcgcagccgctggaatattcgcgcacgtcccccaccgagtggaagtcctccagccagcgcagggggatctaccccgcctccacccagctggaccgcaactctctgtccgagcagcagcagcagcagcgggaggacgaggacgactacgaggctgcctactgggcatccatgaggtcgttctacgagaagaacccgagctgctcgcgcccctggccgcccaaacccaagaacgccatcaccattgctctctcatcctgcgcgctcttcaacatggtggacggcaggaaaatctacgagcaagagggtctggaaaagtacatggagtatcagctcaccaatgagaacgtcatcctgaccccgggcccggcgttccgcttcgtcaaggcactacagtatgtcaatgctagactccgtgatctatatcctgatgaacaggacttatttgatattgtactgatgactaataaccatgcccaagtgggagtgcggcttataaacagcgtcaatcactacggcttactgattgaccgcttctgtctgaccgggggaaaagaccccattggctatttgaaggcatatcttaccaacttgtatattgctgcagattctgaaaaagtgcaagaggcaatacaagaaggtattgcctctgcgacaatgtttgatggagccaaagacatggcttactgtgacactcagctccgtgtagcctttgatggggatgctgtcctcttctctgatgagtctgaacattttaccaaggagcatgggctcgacaaattcttccagtatgatacattatgtgaaagtaagcctcttgctcagggtcccctaaaaggctttctggaagatttaggcagactgcaaaagaagttctatgccaaaaatgaacggttactttgtcctatcaggacctacctggttacagctaggagtgcagccagttcaggcgcccgtgtgctgaagacccttcgacgctggggtctagagatagacgaagctcttttccttgctggagcccccaaaagtcccatcttggtgaagatccggccccacatcttctttgatgaccacatgttccacattgaaggggcacagaggaagagcctaggctggatgtcttgatcaataacgcagggatcttccagtgcccttacatgaagactgaagatgggtttgagatgcagttcggagtgaaccatctggggcactttctactcaccaatcttctccttggactcctcaaaagttcagctcccagcaggattgtggtagtttcttccaaactttataaatacggagacatcaattttgatgacttgaacagtgaacaaagctataataaaagcttttgttatagccggagcaaactggctaacattctttttaccagggaactagcccgccgcttagaaggcacaaatgtcaccgtcaatgtgttgcatcctggtattgtacggacaaatctggggaggcacatacacattccactgttggtcaaaccactcttcaatttggtgtcatgggcttttttcaaaactccagtagaaggtgcccagacttccatttatttggcctcttcacctgaggtagaaggagtgtcaggaagatactttggggattgtaaagaggaagaactgttgcccaaagctatggatgaatctgttgcaagaaaactctgggatatcagtgaagtgatggttggcctgctaaaataggaacaaggagtaaaagagctgtttataaaactgcatatcagttatatctgtgatcaggaatggtgtggattgagaacttgttacttgaagaaaaagaattttgatattggaatagcctgctaagaggtacatgtgggtattttggagttactgaaaaattatttttgggataagagaatttcagcaaagatgttttaaatatatatagtaagtataatgaataataagtacaatgaaaaatacaattatattgtaaaattataactgggcaagcatggatgacatattaatatttgtcagaattaagtgactcaaagtgctatcgagaggtttttcaagtatctttgagtttcatggccaaagtgttaactagttttactacaatgtttggtgtttgtgtggaaattatctgcctggtgtgtgcacacaagtcttacttggaataaatttactggtacaaattcttaa
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.