Home |
Help |
Advanced search
2024-04-16 20:52:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001199056 2505 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens cell death-inducing p53 target 1 (CDIP1), transcript
variant 4, mRNA.
ACCESSION NM_001199056
VERSION NM_001199056.1 GI:312261264
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2505)
AUTHORS Brown-Endres,L., Schoenfeld,D., Tian,F., Kim,H.G., Namba,T.,
Munoz-Fontela,C., Mandinova,A., Aaronson,S.A. and Lee,S.W.
TITLE Expression of the p53 target CDIP correlates with sensitivity to
TNFalpha-induced apoptosis in cancer cells
JOURNAL Cancer Res. 72 (9), 2373-2382 (2012)
PUBMED 22549949
REMARK GeneRIF: CDIP expression correlates with sensitivity of cancer
cells with TNFalpha, and CDIP seems to be a regulator of the
p53-mediated death versus survival response of cells to TNFalpha.
REFERENCE 2 (bases 1 to 2505)
AUTHORS Brown,L., Ongusaha,P.P., Kim,H.G., Nuti,S., Mandinova,A., Lee,J.W.,
Khosravi-Far,R., Aaronson,S.A. and Lee,S.W.
TITLE CDIP, a novel pro-apoptotic gene, regulates TNFalpha-mediated
apoptosis in a p53-dependent manner
JOURNAL EMBO J. 26 (14), 3410-3422 (2007)
PUBMED 17599062
REMARK GeneRIF: These findings support a novel p53 --> CDIP --> TNF-alpha
apoptotic pathway that directs apoptosis after exposure of cells to
genotoxic stress.
REFERENCE 3 (bases 1 to 2505)
AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
TITLE A germline-specific class of small RNAs binds mammalian Piwi
proteins
JOURNAL Nature 442 (7099), 199-202 (2006)
PUBMED 16751776
REFERENCE 4 (bases 1 to 2505)
AUTHORS Bhalla,K., Eyre,H.J., Whitmore,S.A., Sutherland,G.R. and
Callen,D.F.
TITLE C16orf5, a novel proline-rich gene at 16p13.3, is highly expressed
in the brain
JOURNAL J. Hum. Genet. 44 (6), 383-387 (1999)
PUBMED 10570909
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AK308532.1, AK302297.1 and AC007606.8.
Transcript Variant: This variant (4) differs in the 5' UTR and
lacks an alternate internal segemnt compared to variant 1. The
resulting isoform (c) has the same N- and C-termini but is shorter
compared to isoform a.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
##Evidence-Data-START##
Transcript exon combination :: AK302297.1, BI559905.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-42 AK308532.1 14-55
43-668 AK302297.1 1-626
669-2505 AC007606.8 59240-61076 c
FEATURES Location/Qualifiers
source 1..2505
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16p13.3"
gene 1..2505
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/note="cell death-inducing p53 target 1"
/db_xref="GeneID:29965"
/db_xref="HGNC:13234"
/db_xref="MIM:610503"
exon 1..114
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/inference="alignment:Splign:1.39.8"
exon 115..204
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/inference="alignment:Splign:1.39.8"
misc_feature 201..203
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/note="upstream in-frame stop codon"
exon 205..303
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/inference="alignment:Splign:1.39.8"
CDS 219..608
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/note="isoform c is encoded by transcript variant 4;
LITAF-like protein; cell death inducing protein;
transmembrane protein I1; cell death-inducing protein;
cell death involved p53-target; lipopolysaccharide-induced
tumor necrosis factor-alpha-like protein; cell
death-inducing p53-target protein 1"
/codon_start=1
/product="cell death-inducing p53-target protein 1 isoform
c"
/protein_id="NP_001185985.1"
/db_xref="GI:312261265"
/db_xref="CCDS:CCDS58420.1"
/db_xref="GeneID:29965"
/db_xref="HGNC:13234"
/db_xref="MIM:610503"
/translation="
MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC
"
misc_feature 390..599
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/note="LITAF-like zinc ribbon domain; Region:
zf-LITAF-like; pfam10601"
/db_xref="CDD:204526"
exon 304..339
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/inference="alignment:Splign:1.39.8"
exon 340..496
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/inference="alignment:Splign:1.39.8"
exon 497..2505
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/inference="alignment:Splign:1.39.8"
STS 940..1067
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/standard_name="SHGC-60771"
/db_xref="UniSTS:77968"
STS 1488..1749
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/standard_name="SHGC-60849"
/db_xref="UniSTS:58310"
variation 1587
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/replace="g"
/replace="t"
/db_xref="dbSNP:200555498"
STS 1652..1825
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/standard_name="D16S2655"
/db_xref="UniSTS:152395"
variation 1705
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/replace="g"
/replace="t"
/db_xref="dbSNP:17137100"
STS 2345..2450
/gene="CDIP1"
/gene_synonym="C16orf5; CDIP; I1; LITAFL"
/standard_name="SHGC-61112"
/db_xref="UniSTS:51490"
ORIGIN
gggcctcggccctggtccaaagtctacccgcctccttgtgacagaagtgcgactgccagctgccgaggcgttcggtcctgctgttgcggccgctgccccagggctgcggggacgctcccggagccctgcctgttccctgtccatccaggccagcagctgaaggagcctcacctgcctcccttctctgagtagcacggatttgaggagaagcagcgaagatgtccagcgagcctccccctccttatcctgggggccccacagccccacttctggaagagaaaagtggagccccgcccaccccaggccgttcctccccagctgtgatgcagccccctccaggagctgccaccacggtgacagtgctgcagggagagatctttgagggagcgcctgtgcagacggtgtgtccccactgccagcaggccatcaccaccaagatctcctacgagattggcttgatgaatttcgtgctgggtttcttctgttgcttcatgggatgtgatctgggctgctgcctgatcccctgcctcatcaatgacttcaaggatgtgacgcacacatgccccagctgcaaagcctacatctacacgtacaagcgcctgtgctaacggagctgggactcgggactcccccgcctgtcagtctggccccctgtgctttgctccctgtgctcagtggtcactttcccgctcccacttggggctgggagccgtgccaccatcccctagaagtcctgtcctcttcaccctgccctacctgagccgctgactcttctggcaaaaattctgttgggatttaaggccaagggtcagtgggtggcagggggctgacaatgagcttgtgtgttgttggtctgcttggtgtgtgtgatcgggaagataagctgggaggggtctcctgctggggtcctgatgcctctgtttccaaacaaggtacaggttcagtccagactctttccccctgggaccaacagcagccagagcagttagccagttagtccccaggcctgtggccacaggcgtttctgacctgctgggccgagaatgggtaagttgtctggagtcaggtgggcccacgtaggacagggtcacaaagcctgggtttgtttctgggtactttgcgcctctggggtgctagaggtggggcatggtggctggaagtaaaactgccaactctggccctcagaactctcaggtatagaagcccaggatgtctaataccctgtcccagtgcccgagagctgcctggtgtcaggtagagaggacactgtacctgggtgaatgatcagaccctggtagctaagaaggaacttgtccctttgagtcagtgtgcagaccccctttcaggccatgcctctgtgaaccctgtattgctggggccggaaggagcccctgagcctagccccttcccgtctgccctgtgtcctcactgcgtgtgggtatgacctctgcctggtggctggtgtatcccaactgggcaagagatggcagagggtcccccttgtgggtgcgcttggatgtgcagagccttctccatggattttcttccctgtaagtgccgggcccctcaccccagctgacaggctgttgctgtgcctgctcacacctgctcctgcaggcacactgggctagggacgaggaaggagcagccacaagtggtagaactgccttggtggacaccagcctcgccctgtctttatttcctgaatggtttgtgaacttgctcacctggaccactgtatcctgccactgtccttcctggtctcgcactgccactgcatggcctcctgtcactgtgaatcgtggcccagtctcagtttgtagtttctcattaaattggccctttcactcccccgccctgggcctctgctctcttgcctggcttccttcttttttgagggaaagagggtggggctgcaggcagtctactggcaggacgggaggctgagtcctcagggtctcacaccctcagtgctgatgccatgccaactgcctgggacaacaccaacacgtaaggacctaattaaaccaaaccagagtcgggtgtagaccagccctgggatttccagctgtgactgggccagggcacacgttggtctcggcagtggctgtaaggtcaccttccttcctctgatgctggtttcaaccatctatatatggcatccacgcatgggatctgcaagctggagccctcctacccgcaggcttgagcacagcatcatccagccctggggaggcgcacccttaagcaacacagactgggctgaggctgacaggcagaagactaacagagcgcagtctgcacacgcaggttctgggcgacctctggccctggccatctctgcactaactcatctgaattatgaaggtggcagtcttggtcagtagtttaaagagtttccctactttttaaccctttttgaaataaaacttttacaggtagtagattcctattaataaaattatttaagttcatgtttctcttttagagaatgaattgtttaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:29965 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
GeneID:29965 -> Biological process: GO:0006915 [apoptotic process] evidence: IGI
GeneID:29965 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IDA
GeneID:29965 -> Biological process: GO:0033209 [tumor necrosis factor-mediated signaling pathway] evidence: IGI
GeneID:29965 -> Biological process: GO:0042771 [intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator] evidence: IMP
GeneID:29965 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:29965 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.