2024-04-20 09:26:54, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001199055 2625 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens cell death-inducing p53 target 1 (CDIP1), transcript variant 3, mRNA. ACCESSION NM_001199055 VERSION NM_001199055.1 GI:312261262 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2625) AUTHORS Brown-Endres,L., Schoenfeld,D., Tian,F., Kim,H.G., Namba,T., Munoz-Fontela,C., Mandinova,A., Aaronson,S.A. and Lee,S.W. TITLE Expression of the p53 target CDIP correlates with sensitivity to TNFalpha-induced apoptosis in cancer cells JOURNAL Cancer Res. 72 (9), 2373-2382 (2012) PUBMED 22549949 REMARK GeneRIF: CDIP expression correlates with sensitivity of cancer cells with TNFalpha, and CDIP seems to be a regulator of the p53-mediated death versus survival response of cells to TNFalpha. REFERENCE 2 (bases 1 to 2625) AUTHORS Brown,L., Ongusaha,P.P., Kim,H.G., Nuti,S., Mandinova,A., Lee,J.W., Khosravi-Far,R., Aaronson,S.A. and Lee,S.W. TITLE CDIP, a novel pro-apoptotic gene, regulates TNFalpha-mediated apoptosis in a p53-dependent manner JOURNAL EMBO J. 26 (14), 3410-3422 (2007) PUBMED 17599062 REMARK GeneRIF: These findings support a novel p53 --> CDIP --> TNF-alpha apoptotic pathway that directs apoptosis after exposure of cells to genotoxic stress. REFERENCE 3 (bases 1 to 2625) AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A. TITLE A germline-specific class of small RNAs binds mammalian Piwi proteins JOURNAL Nature 442 (7099), 199-202 (2006) PUBMED 16751776 REFERENCE 4 (bases 1 to 2625) AUTHORS Bhalla,K., Eyre,H.J., Whitmore,S.A., Sutherland,G.R. and Callen,D.F. TITLE C16orf5, a novel proline-rich gene at 16p13.3, is highly expressed in the brain JOURNAL J. Hum. Genet. 44 (6), 383-387 (1999) PUBMED 10570909 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK308532.1, AK294257.1 and AC007606.8. Transcript Variant: This variant (3) differs in the 5' UTR and uses an alternate in-frame splice junction at the 5' end of an exon compared to variant 1. The resulting isoform (b) has the same N- and C-termini but is shorter compared to isoform a. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK294257.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 AK308532.1 14-44 32-788 AK294257.1 2-758 789-2625 AC007606.8 59240-61076 c FEATURES Location/Qualifiers source 1..2625 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="16" /map="16p13.3" gene 1..2625 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /note="cell death-inducing p53 target 1" /db_xref="GeneID:29965" /db_xref="HGNC:13234" /db_xref="MIM:610503" exon 1..114 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /inference="alignment:Splign:1.39.8" exon 115..204 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /inference="alignment:Splign:1.39.8" misc_feature 201..203 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /note="upstream in-frame stop codon" exon 205..303 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /inference="alignment:Splign:1.39.8" CDS 219..728 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /note="isoform b is encoded by transcript variant 3; LITAF-like protein; cell death inducing protein; transmembrane protein I1; cell death-inducing protein; cell death involved p53-target; lipopolysaccharide-induced tumor necrosis factor-alpha-like protein; cell death-inducing p53-target protein 1" /codon_start=1 /product="cell death-inducing p53-target protein 1 isoform b" /protein_id="NP_001185984.1" /db_xref="GI:312261263" /db_xref="CCDS:CCDS58419.1" /db_xref="GeneID:29965" /db_xref="HGNC:13234" /db_xref="MIM:610503" /translation="
MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC
" misc_feature 510..719 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /note="LITAF-like zinc ribbon domain; Region: zf-LITAF-like; pfam10601" /db_xref="CDD:204526" exon 304..459 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /inference="alignment:Splign:1.39.8" exon 460..616 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /inference="alignment:Splign:1.39.8" exon 617..2625 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /inference="alignment:Splign:1.39.8" STS 1060..1187 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /standard_name="SHGC-60771" /db_xref="UniSTS:77968" STS 1608..1869 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /standard_name="SHGC-60849" /db_xref="UniSTS:58310" variation 1707 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /replace="g" /replace="t" /db_xref="dbSNP:200555498" STS 1772..1945 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /standard_name="D16S2655" /db_xref="UniSTS:152395" variation 1825 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /replace="g" /replace="t" /db_xref="dbSNP:17137100" STS 2465..2570 /gene="CDIP1" /gene_synonym="C16orf5; CDIP; I1; LITAFL" /standard_name="SHGC-61112" /db_xref="UniSTS:51490" ORIGIN
gggcctcggccctggtccaaagtctacccgcctccttgtgacagaagtgcgactgccagctgccgaggcgttcggtcctgctgttgcggccgctgccccagggctgcggggacgctcccggagccctgcctgttccctgtccatccaggccagcagctgaaggagcctcacctgcctcccttctctgagtagcacggatttgaggagaagcagcgaagatgtccagcgagcctccccctccttatcctgggggccccacagccccacttctggaagagaaaagtggagccccgcccaccccaggccgttcctccccagctgtgatgcagccccctccaggcatgccactgccccctgcggacattggccccccaccctatgagccgccgggtcacccaatgccccagcctggcttcatcccaccacacatgagtgcagatggcacctacatgcctccgggagctgccaccacggtgacagtgctgcagggagagatctttgagggagcgcctgtgcagacggtgtgtccccactgccagcaggccatcaccaccaagatctcctacgagattggcttgatgaatttcgtgctgggtttcttctgttgcttcatgggatgtgatctgggctgctgcctgatcccctgcctcatcaatgacttcaaggatgtgacgcacacatgccccagctgcaaagcctacatctacacgtacaagcgcctgtgctaacggagctgggactcgggactcccccgcctgtcagtctggccccctgtgctttgctccctgtgctcagtggtcactttcccgctcccacttggggctgggagccgtgccaccatcccctagaagtcctgtcctcttcaccctgccctacctgagccgctgactcttctggcaaaaattctgttgggatttaaggccaagggtcagtgggtggcagggggctgacaatgagcttgtgtgttgttggtctgcttggtgtgtgtgatcgggaagataagctgggaggggtctcctgctggggtcctgatgcctctgtttccaaacaaggtacaggttcagtccagactctttccccctgggaccaacagcagccagagcagttagccagttagtccccaggcctgtggccacaggcgtttctgacctgctgggccgagaatgggtaagttgtctggagtcaggtgggcccacgtaggacagggtcacaaagcctgggtttgtttctgggtactttgcgcctctggggtgctagaggtggggcatggtggctggaagtaaaactgccaactctggccctcagaactctcaggtatagaagcccaggatgtctaataccctgtcccagtgcccgagagctgcctggtgtcaggtagagaggacactgtacctgggtgaatgatcagaccctggtagctaagaaggaacttgtccctttgagtcagtgtgcagaccccctttcaggccatgcctctgtgaaccctgtattgctggggccggaaggagcccctgagcctagccccttcccgtctgccctgtgtcctcactgcgtgtgggtatgacctctgcctggtggctggtgtatcccaactgggcaagagatggcagagggtcccccttgtgggtgcgcttggatgtgcagagccttctccatggattttcttccctgtaagtgccgggcccctcaccccagctgacaggctgttgctgtgcctgctcacacctgctcctgcaggcacactgggctagggacgaggaaggagcagccacaagtggtagaactgccttggtggacaccagcctcgccctgtctttatttcctgaatggtttgtgaacttgctcacctggaccactgtatcctgccactgtccttcctggtctcgcactgccactgcatggcctcctgtcactgtgaatcgtggcccagtctcagtttgtagtttctcattaaattggccctttcactcccccgccctgggcctctgctctcttgcctggcttccttcttttttgagggaaagagggtggggctgcaggcagtctactggcaggacgggaggctgagtcctcagggtctcacaccctcagtgctgatgccatgccaactgcctgggacaacaccaacacgtaaggacctaattaaaccaaaccagagtcgggtgtagaccagccctgggatttccagctgtgactgggccagggcacacgttggtctcggcagtggctgtaaggtcaccttccttcctctgatgctggtttcaaccatctatatatggcatccacgcatgggatctgcaagctggagccctcctacccgcaggcttgagcacagcatcatccagccctggggaggcgcacccttaagcaacacagactgggctgaggctgacaggcagaagactaacagagcgcagtctgcacacgcaggttctgggcgacctctggccctggccatctctgcactaactcatctgaattatgaaggtggcagtcttggtcagtagtttaaagagtttccctactttttaaccctttttgaaataaaacttttacaggtagtagattcctattaataaaattatttaagttcatgtttctcttttagagaatgaattgtttaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:29965 -> Molecular function: GO:0003674 [molecular_function] evidence: ND GeneID:29965 -> Biological process: GO:0006915 [apoptotic process] evidence: IGI GeneID:29965 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IDA GeneID:29965 -> Biological process: GO:0033209 [tumor necrosis factor-mediated signaling pathway] evidence: IGI GeneID:29965 -> Biological process: GO:0042771 [intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator] evidence: IMP GeneID:29965 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:29965 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.