2024-03-28 18:19:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001199012 2820 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens sperm-tail PG-rich repeat containing 1 (STPG1), transcript variant 2, mRNA. ACCESSION NM_001199012 VERSION NM_001199012.1 GI:312222698 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2820) AUTHORS Fujikane,R., Sanada,M., Sekiguchi,M. and Hidaka,M. TITLE The identification of a novel gene, MAPO2, that is involved in the induction of apoptosis triggered by O(6)-methylguanine JOURNAL PLoS ONE 7 (9), E44817 (2012) PUBMED 23028632 REMARK GeneRIF: MAPO2 gene product might positively contribute to the induction of apoptosis triggered by O-methylguanine COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC040212.1 and BC063891.1. Transcript Variant: This variant (2) has an alternate 5' UTR compared to variant 1. Variants 1 and 2 encode the same isoform 1. ##Evidence-Data-START## Transcript exon combination :: BC040212.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025085 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-405 BC040212.1 3-407 406-2756 BC063891.1 350-2700 2757-2820 BC040212.1 2759-2822 FEATURES Location/Qualifiers source 1..2820 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p36.11" gene 1..2820 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /note="sperm-tail PG-rich repeat containing 1" /db_xref="GeneID:90529" /db_xref="HGNC:28070" exon 1..187 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" exon 188..325 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" misc_feature 208..210 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /note="upstream in-frame stop codon" CDS 256..1260 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /note="isoform 1 is encoded by transcript variant 2; UPF0490 protein C1orf201; sperm-tail PG-rich repeat-containing protein 1; O6-methylguanine-induced apoptosis 2; O(6)-methylguanine-induced apoptosis 2" /codon_start=1 /product="O(6)-methylguanine-induced apoptosis 2 isoform 1" /protein_id="NP_001185941.1" /db_xref="GI:312222699" /db_xref="CCDS:CCDS55581.1" /db_xref="GeneID:90529" /db_xref="HGNC:28070" /translation="
MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFPHKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL
" misc_feature 454..477 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1); Region: STPGR 1" misc_feature 469..471 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine; propagated from UniProtKB/Swiss-Prot (Q5TH74.1); phosphorylation site" misc_feature 580..606 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1); Region: STPGR 2" misc_feature 697..720 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1); Region: STPGR 3" misc_feature 814..873 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1); Region: STPGR 4" misc_feature 928..1026 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1); Region: STPGR 5" misc_feature 1054..1101 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1); Region: STPGR 6" misc_feature 1171..1203 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1); Region: STPGR 7" exon 326..444 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" exon 445..546 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" variation 533 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /replace="c" /replace="t" /db_xref="dbSNP:11538189" exon 547..717 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" variation 568 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /replace="a" /replace="g" /db_xref="dbSNP:1142057" variation 591 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /replace="c" /replace="t" /db_xref="dbSNP:1064842" variation 642 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /replace="a" /replace="g" /db_xref="dbSNP:11538188" exon 718..826 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" exon 827..992 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" exon 993..1183 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" exon 1184..2804 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /inference="alignment:Splign:1.39.8" STS 2558..2731 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /standard_name="SHGC-74407" /db_xref="UniSTS:74166" variation 2615 /gene="STPG1" /gene_synonym="C1orf201; MAPO2" /replace="c" /replace="t" /db_xref="dbSNP:1047696" ORIGIN
tcgtcacagccatgagtgagacttgaagcccgttttacgtatgaagaaatgtcatttgggcctagacatcaacaatgagaaagaggcagttctagtctcagatcgtggggcagagaaagctccttgggaacatgggagaggaacgagttggtgcattgtagaaactgcccgaaggccagcagggctggtgcttaggagaacatgcagtagaacttttcatcaaacaaatggaacacgtcacagaattttgctaacatggacaactctgcacagaaaaatgaacgcactggcaaacatcccagacgtgccagtgaagtacagaaaggttttactgctgcatatccaacacaatcctccattccttttaaatctcaagcttcagtaatcccagaatcagaaaaaaaaggattcaatagtcaagccaagagatttcctcataagaagaatgatatcccaggacctgggttctacaatgttattcaccagtcaccggtgtccaacagtgtctcattgtccaagaaaggaacttgcatgtttccctcaatgtgcgcccgattggacaccatcatttctaaataccctgcagcgaatgcatacactatcccatcggattttatttccaagagagactttagtaattcgtgttccagcatgttccagttgccaagctttatgaaagctctcaagtttgaaactcctgcaccaaactattacaatgcctctgtctcttgctgcaagcagagaaacaacgtctgtactcgagccgggtttatgtcaaaaacccaaagaggatctttcgcttttgctgataaaggacctcccccagggcattatgatatcaacgaatcccttgtgaagcagtcgccaaatacattaatgtcttgttttaaatcaaaaaccaaccgtggattaaaactgacgtcaacaggcccgggacctggttattacaaccccagtgattgcacaaaagttccaaaaaagactcttttcccgaaaaaccccatcctgaacttctctgctcagccttcgcctctgcctccgaagccacctttcccaggtcctggtcagtatgagatcgtggactacttaggcccccgcaagcatttcatctctagtgcatcattcgtgtccaataccagccggtggacagcggcgccgcctcagccaggcctgcctggcccagctacgtacaagccagagcttccaggaaagcagtccttcctctacaacgaggacaagaaatggatcccggttctgtagggatgtcacacaaggtcaaggagaactccagccaccagcccaccctgcccagcgtccccaggacattcctcaggaggagaccgatcatgagtgtggcagctgacaacttggggggtggctctaccactctggcctggcatcctagccggactgctgccattgcctttgtcttgagctggagacattgctccctggagacttcaccccagccccacagactccagtggcttcctgagcagaagggaggagtggacagagccccctggctgcttccccacgcacccatccaggctgccttccggcacgactccctgccgcagactgaagggactcctgaagcgcagacttcaaggaggatcagtccaccctgaaggtggccaagcctggaagccccacccttccctgtttcattccttcattcatttacacattcattcattccctcactcctgcctttctcatttgtccctttctgacctcactcacttacggtatgtctactgggcgaaagctacctgcaggcaggtgatgctttttccaccagtccacagcttcctttctaaagtgaccacctgtttggaaagacctctctttactccttttagacctttttctctttggagtgggagatcatcttggaatggcagtggccgggcccgggggctgcgcttttccctgactttctctgctggcgggactgaattttctcaaggcttacaggcccttccatggagtccacatggcctgtctaggcctgatagctttcgtctctctatgtggagggaaaaagaaatgtgccctagtggttttggtggaggctgcacagattcgcggtgggtggggagctgccaggctccttttctgatctcccagcaggctttgactgacgctgtttagtctttctgtacattaaccccgccagataccgagaggttacaaagcctccaaggcctgtacaactgtggcctctccagagaagtggttctcagccttgactgcacactgtaatcacctggggactttaaaaagtactgaggcctggggcccacccacaaatgctgatttaactcctccagggtggggtctgggcagtggggaggcaggagccacccaggtgattccaatgataggtgtaggttgagaagcgccaccttccagcttcctaactggctctgggaggggagctgggtgggaagttcaggaggtgggaactttgtacacgcagagcacctggagcacctacagcatggctgtggttccacactcctctgtcatttaaccttcacacatcacctcgttctgacatcaagggtgcgtcacagccacagtgaggcctcgcctgggcagagcaactctgggtgccccactgggtccctcccacaggggcaggcaagcctaatgggaacccgaggcaaaaggaaacatcagtaatacgaatcctgtctttaaaactgtgatgttttgttcaccatggattttttttttgggggggggggccttaattttaaaaatattgcattaaacttatttatcttgcttattgaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:90529 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:90529 -> Cellular component: GO:0005634 [nucleus] evidence: IEA GeneID:90529 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.