GGRNA Home | Help | Advanced search

2024-03-28 18:19:14, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001199012            2820 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens sperm-tail PG-rich repeat containing 1 (STPG1),
            transcript variant 2, mRNA.
ACCESSION   NM_001199012
VERSION     NM_001199012.1  GI:312222698
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2820)
  AUTHORS   Fujikane,R., Sanada,M., Sekiguchi,M. and Hidaka,M.
  TITLE     The identification of a novel gene, MAPO2, that is involved in the
            induction of apoptosis triggered by O(6)-methylguanine
  JOURNAL   PLoS ONE 7 (9), E44817 (2012)
   PUBMED   23028632
  REMARK    GeneRIF: MAPO2 gene product might positively contribute to the
            induction of apoptosis triggered by O-methylguanine
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC040212.1 and BC063891.1.
            
            Transcript Variant: This variant (2) has an alternate 5' UTR
            compared to variant 1. Variants 1 and 2 encode the same isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC040212.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-405               BC040212.1         3-407
            406-2756            BC063891.1         350-2700
            2757-2820           BC040212.1         2759-2822
FEATURES             Location/Qualifiers
     source          1..2820
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p36.11"
     gene            1..2820
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /note="sperm-tail PG-rich repeat containing 1"
                     /db_xref="GeneID:90529"
                     /db_xref="HGNC:28070"
     exon            1..187
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     exon            188..325
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    208..210
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /note="upstream in-frame stop codon"
     CDS             256..1260
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /note="isoform 1 is encoded by transcript variant 2;
                     UPF0490 protein C1orf201; sperm-tail PG-rich
                     repeat-containing protein 1; O6-methylguanine-induced
                     apoptosis 2; O(6)-methylguanine-induced apoptosis 2"
                     /codon_start=1
                     /product="O(6)-methylguanine-induced apoptosis 2 isoform
                     1"
                     /protein_id="NP_001185941.1"
                     /db_xref="GI:312222699"
                     /db_xref="CCDS:CCDS55581.1"
                     /db_xref="GeneID:90529"
                     /db_xref="HGNC:28070"
                     /translation="
MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFPHKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL
"
     misc_feature    454..477
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1);
                     Region: STPGR 1"
     misc_feature    469..471
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphotyrosine; propagated from
                     UniProtKB/Swiss-Prot (Q5TH74.1); phosphorylation site"
     misc_feature    580..606
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1);
                     Region: STPGR 2"
     misc_feature    697..720
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1);
                     Region: STPGR 3"
     misc_feature    814..873
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1);
                     Region: STPGR 4"
     misc_feature    928..1026
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1);
                     Region: STPGR 5"
     misc_feature    1054..1101
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1);
                     Region: STPGR 6"
     misc_feature    1171..1203
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5TH74.1);
                     Region: STPGR 7"
     exon            326..444
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     exon            445..546
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     variation       533
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11538189"
     exon            547..717
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     variation       568
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1142057"
     variation       591
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1064842"
     variation       642
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11538188"
     exon            718..826
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     exon            827..992
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     exon            993..1183
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     exon            1184..2804
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /inference="alignment:Splign:1.39.8"
     STS             2558..2731
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /standard_name="SHGC-74407"
                     /db_xref="UniSTS:74166"
     variation       2615
                     /gene="STPG1"
                     /gene_synonym="C1orf201; MAPO2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047696"
ORIGIN      
tcgtcacagccatgagtgagacttgaagcccgttttacgtatgaagaaatgtcatttgggcctagacatcaacaatgagaaagaggcagttctagtctcagatcgtggggcagagaaagctccttgggaacatgggagaggaacgagttggtgcattgtagaaactgcccgaaggccagcagggctggtgcttaggagaacatgcagtagaacttttcatcaaacaaatggaacacgtcacagaattttgctaacatggacaactctgcacagaaaaatgaacgcactggcaaacatcccagacgtgccagtgaagtacagaaaggttttactgctgcatatccaacacaatcctccattccttttaaatctcaagcttcagtaatcccagaatcagaaaaaaaaggattcaatagtcaagccaagagatttcctcataagaagaatgatatcccaggacctgggttctacaatgttattcaccagtcaccggtgtccaacagtgtctcattgtccaagaaaggaacttgcatgtttccctcaatgtgcgcccgattggacaccatcatttctaaataccctgcagcgaatgcatacactatcccatcggattttatttccaagagagactttagtaattcgtgttccagcatgttccagttgccaagctttatgaaagctctcaagtttgaaactcctgcaccaaactattacaatgcctctgtctcttgctgcaagcagagaaacaacgtctgtactcgagccgggtttatgtcaaaaacccaaagaggatctttcgcttttgctgataaaggacctcccccagggcattatgatatcaacgaatcccttgtgaagcagtcgccaaatacattaatgtcttgttttaaatcaaaaaccaaccgtggattaaaactgacgtcaacaggcccgggacctggttattacaaccccagtgattgcacaaaagttccaaaaaagactcttttcccgaaaaaccccatcctgaacttctctgctcagccttcgcctctgcctccgaagccacctttcccaggtcctggtcagtatgagatcgtggactacttaggcccccgcaagcatttcatctctagtgcatcattcgtgtccaataccagccggtggacagcggcgccgcctcagccaggcctgcctggcccagctacgtacaagccagagcttccaggaaagcagtccttcctctacaacgaggacaagaaatggatcccggttctgtagggatgtcacacaaggtcaaggagaactccagccaccagcccaccctgcccagcgtccccaggacattcctcaggaggagaccgatcatgagtgtggcagctgacaacttggggggtggctctaccactctggcctggcatcctagccggactgctgccattgcctttgtcttgagctggagacattgctccctggagacttcaccccagccccacagactccagtggcttcctgagcagaagggaggagtggacagagccccctggctgcttccccacgcacccatccaggctgccttccggcacgactccctgccgcagactgaagggactcctgaagcgcagacttcaaggaggatcagtccaccctgaaggtggccaagcctggaagccccacccttccctgtttcattccttcattcatttacacattcattcattccctcactcctgcctttctcatttgtccctttctgacctcactcacttacggtatgtctactgggcgaaagctacctgcaggcaggtgatgctttttccaccagtccacagcttcctttctaaagtgaccacctgtttggaaagacctctctttactccttttagacctttttctctttggagtgggagatcatcttggaatggcagtggccgggcccgggggctgcgcttttccctgactttctctgctggcgggactgaattttctcaaggcttacaggcccttccatggagtccacatggcctgtctaggcctgatagctttcgtctctctatgtggagggaaaaagaaatgtgccctagtggttttggtggaggctgcacagattcgcggtgggtggggagctgccaggctccttttctgatctcccagcaggctttgactgacgctgtttagtctttctgtacattaaccccgccagataccgagaggttacaaagcctccaaggcctgtacaactgtggcctctccagagaagtggttctcagccttgactgcacactgtaatcacctggggactttaaaaagtactgaggcctggggcccacccacaaatgctgatttaactcctccagggtggggtctgggcagtggggaggcaggagccacccaggtgattccaatgataggtgtaggttgagaagcgccaccttccagcttcctaactggctctgggaggggagctgggtgggaagttcaggaggtgggaactttgtacacgcagagcacctggagcacctacagcatggctgtggttccacactcctctgtcatttaaccttcacacatcacctcgttctgacatcaagggtgcgtcacagccacagtgaggcctcgcctgggcagagcaactctgggtgccccactgggtccctcccacaggggcaggcaagcctaatgggaacccgaggcaaaaggaaacatcagtaatacgaatcctgtctttaaaactgtgatgttttgttcaccatggattttttttttgggggggggggccttaattttaaaaatattgcattaaacttatttatcttgcttattgaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:90529 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:90529 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
            GeneID:90529 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.