Home |
Help |
Advanced search
2024-04-25 18:31:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001197320 3648 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens myeloid cell leukemia sequence 1 (BCL2-related)
(MCL1), transcript variant 3, mRNA.
ACCESSION NM_001197320
VERSION NM_001197320.1 GI:309747066
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3648)
AUTHORS Casanelles,E., Gozzelino,R., Marques-Fernandez,F.,
Iglesias-Guimarais,V., Garcia-Belinchon,M., Sanchez-Osuna,M.,
Sole,C., Moubarak,R.S., Comella,J.X. and Yuste,V.J.
TITLE NF-kappaB activation fails to protect cells to TNFalpha-induced
apoptosis in the absence of Bcl-xL, but not Mcl-1, Bcl-2 or Bcl-w
JOURNAL Biochim. Biophys. Acta 1833 (5), 1085-1095 (2013)
PUBMED 23369735
REMARK GeneRIF: we describe that the specific knockdown of Bcl-xL, but not
that of Bcl-2, Bcl-w or Mcl-1, renders cells sensitive to
TNFalpha-induced apoptosis.
REFERENCE 2 (bases 1 to 3648)
AUTHORS Cai,M., Chen,Q., Chen,C., Liu,X., Hou,J., Zeng,C., Shu,Q. and
Fang,X.
TITLE Activation of triggering receptor expressed on myeloid cells-1
protects monocyte from apoptosis through regulation of myeloid cell
leukemia-1
JOURNAL Anesthesiology 118 (5), 1140-1149 (2013)
PUBMED 23364598
REMARK GeneRIF: Activation of TREM-1 protected monocytic cells from
apoptosis through activation of extracellular signal-regulated
kinase and v-akt murine thymoma viral oncogene homologue pathways
and MCL1
REFERENCE 3 (bases 1 to 3648)
AUTHORS Kim,J.H., Sim,S.H., Ha,H.J., Ko,J.J., Lee,K. and Bae,J.
TITLE MCL-1ES, a novel variant of MCL-1, associates with MCL-1L and
induces mitochondrial cell death
JOURNAL FEBS Lett. 583 (17), 2758-2764 (2009)
PUBMED 19683529
REMARK GeneRIF: Data show that MCL-1ES interacts with MCL-1L and induces
mitochondrial cell death, suggesting that alternative splicing of
MCL-1 may control the fate of cells.
REFERENCE 4 (bases 1 to 3648)
AUTHORS Fujise,K., Zhang,D., Liu,J. and Yeh,E.T.
TITLE Regulation of apoptosis and cell cycle progression by MCL1.
Differential role of proliferating cell nuclear antigen
JOURNAL J. Biol. Chem. 275 (50), 39458-39465 (2000)
PUBMED 10978339
REFERENCE 5 (bases 1 to 3648)
AUTHORS Bae,J., Leo,C.P., Hsu,S.Y. and Hsueh,A.J.
TITLE MCL-1S, a splicing variant of the antiapoptotic BCL-2 family member
MCL-1, encodes a proapoptotic protein possessing only the BH3
domain
JOURNAL J. Biol. Chem. 275 (33), 25255-25261 (2000)
PUBMED 10837489
REFERENCE 6 (bases 1 to 3648)
AUTHORS Akgul,C., Turner,P.C., White,M.R. and Edwards,S.W.
TITLE Functional analysis of the human MCL-1 gene
JOURNAL Cell. Mol. Life Sci. 57 (4), 684-691 (2000)
PUBMED 11130466
REFERENCE 7 (bases 1 to 3648)
AUTHORS Umezawa,A., Maruyama,T., Inazawa,J., Imai,S., Takano,T. and Hata,J.
TITLE Induction of mcl1/EAT, Bcl-2 related gene, by retinoic acid or heat
shock in the human embryonal carcinoma cells, NCR-G3
JOURNAL Cell Struct. Funct. 21 (2), 143-150 (1996)
PUBMED 8790944
REFERENCE 8 (bases 1 to 3648)
AUTHORS Yang,T., Kozopas,K.M. and Craig,R.W.
TITLE The intracellular distribution and pattern of expression of Mcl-1
overlap with, but are not identical to, those of Bcl-2
JOURNAL J. Cell Biol. 128 (6), 1173-1184 (1995)
PUBMED 7896880
REFERENCE 9 (bases 1 to 3648)
AUTHORS Craig,R.W., Jabs,E.W., Zhou,P., Kozopas,K.M., Hawkins,A.L.,
Rochelle,J.M., Seldin,M.F. and Griffin,C.A.
TITLE Human and mouse chromosomal mapping of the myeloid cell leukemia-1
gene: MCL1 maps to human chromosome 1q21, a region that is
frequently altered in preneoplastic and neoplastic disease
JOURNAL Genomics 23 (2), 457-463 (1994)
PUBMED 7835896
REFERENCE 10 (bases 1 to 3648)
AUTHORS Kozopas,K.M., Yang,T., Buchan,H.L., Zhou,P. and Craig,R.W.
TITLE MCL1, a gene expressed in programmed myeloid cell differentiation,
has sequence similarity to BCL2
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 90 (8), 3516-3520 (1993)
PUBMED 7682708
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AL356356.17, AK312508.1,
FJ917536.1, BC017197.2 and CA421486.1.
Summary: This gene encodes an anti-apoptotic protein, which is a
member of the Bcl-2 family. Alternative splicing results in
multiple transcript variants. The longest gene product (isoform 1)
enhances cell survival by inhibiting apoptosis while the
alternatively spliced shorter gene products (isoform 2 and isoform
3) promote apoptosis and are death-inducing. [provided by RefSeq,
Oct 2010].
Transcript Variant: This variant (3), also known as MCL-1ES (extra
short), uses an alternate in-frame splice site in the 5' coding
region, compared to variant 1. This results in a shorter protein
(isoform 3), compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: FJ917536.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: inferred from homology
##RefSeq-Attributes-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-128 AL356356.17 106873-107000 c
129-208 AK312508.1 1-80
209-449 FJ917536.1 1-241
450-450 AL356356.17 105741-105741 c
451-708 FJ917536.1 243-500
709-3325 BC017197.2 1014-3630
3326-3648 CA421486.1 1-323 c
FEATURES Location/Qualifiers
source 1..3648
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q21"
gene 1..3648
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="myeloid cell leukemia sequence 1 (BCL2-related)"
/db_xref="GeneID:4170"
/db_xref="HGNC:6943"
/db_xref="MIM:159552"
exon 1..316
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/inference="alignment:Splign:1.39.8"
variation 56
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="t"
/db_xref="dbSNP:34468496"
variation 78
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:28365857"
misc_feature 101..103
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="upstream in-frame stop codon"
misc_feature 129
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="major transcription initiation site"
variation 132
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:201480865"
variation 173
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:16837903"
CDS 209..802
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="isoform 3 is encoded by transcript variant 3;
induced myeloid leukemia cell differentiation protein
Mcl-1; myeloid cell leukemia ES; bcl-2-like protein 3;
bcl-2-related protein EAT/mcl1"
/codon_start=1
/product="induced myeloid leukemia cell differentiation
protein Mcl-1 isoform 3"
/protein_id="NP_001184249.1"
/db_xref="GI:309747067"
/db_xref="GeneID:4170"
/db_xref="HGNC:6943"
/db_xref="MIM:159552"
/translation="
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
"
misc_feature 353..703
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="Apoptosis regulator proteins of the Bcl-2 family,
named after B-cell lymphoma 2. This alignment model spans
what have been described as Bcl-2 homology regions BH1,
BH2, BH3, and BH4. Many members of this family have an
additional C-terminal transmembrane...; Region:
Bcl-2_like; cd06845"
/db_xref="CDD:132900"
misc_feature 386..412
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="BH3; other site"
/db_xref="CDD:132900"
misc_feature order(395..400,404..409,419..421,428..433,479..484,
491..496,503..508,527..529,533..538,542..547,557..559,
569..571,701..703)
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="BH3-homology region binding site; other site"
/db_xref="CDD:132900"
misc_feature order(503..511,524..562)
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="BH1; other site"
/db_xref="CDD:132900"
misc_feature 659..703
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/note="BH2; other site"
/db_xref="CDD:132900"
exon 317..437
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/inference="alignment:Splign:1.39.8"
exon 438..685
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/inference="alignment:Splign:1.39.8"
variation 481
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="g"
/db_xref="dbSNP:34645101"
exon 686..3630
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/inference="alignment:Splign:1.39.8"
variation 840..841
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace=""
/replace="ccacca"
/db_xref="dbSNP:34100999"
variation 1035..1038
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace=""
/replace="aaac"
/db_xref="dbSNP:34664576"
variation 1068
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:34896634"
variation 1127
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="g"
/replace="t"
/db_xref="dbSNP:34355066"
STS 1313..2196
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/standard_name="MCL1_369"
/db_xref="UniSTS:277483"
variation 1412
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:2737825"
variation 1524
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:2737826"
variation 1741
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:200885702"
variation 1765..1769
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace=""
/replace="atag"
/replace="taga"
/db_xref="dbSNP:3065111"
variation 1862..1863
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace=""
/replace="ag"
/db_xref="dbSNP:34035628"
variation 1994
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="c"
/db_xref="dbSNP:1802505"
STS 2012..2145
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/standard_name="D1S3568"
/db_xref="UniSTS:60888"
variation 2078
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:1801298"
variation 2175
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="g"
/db_xref="dbSNP:35900369"
polyA_signal 2189..2194
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
polyA_site 2219
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
variation 2256..2257
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace=""
/replace="g"
/db_xref="dbSNP:199858277"
variation 2256
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="g"
/replace="t"
/db_xref="dbSNP:199960497"
variation 2349
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="t"
/db_xref="dbSNP:1051373"
variation 2403
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:34164836"
variation 2719
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:35392872"
variation 2830
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:35176837"
variation 2853
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11549748"
STS 2903..3003
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/standard_name="SHGC-34987"
/db_xref="UniSTS:5380"
variation 3006
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace=""
/replace="t"
/db_xref="dbSNP:200484447"
variation 3151
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="c"
/db_xref="dbSNP:35351880"
variation 3173..3174
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace=""
/replace="tg"
/db_xref="dbSNP:35609481"
variation 3177
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="g"
/db_xref="dbSNP:35150036"
STS 3192..3401
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/standard_name="SHGC-2474"
/db_xref="UniSTS:39796"
STS 3216..3488
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/standard_name="WI-20019"
/db_xref="UniSTS:47749"
STS 3319..3485
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/standard_name="RH67950"
/db_xref="UniSTS:88241"
STS 3360..3582
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/standard_name="RH68997"
/db_xref="UniSTS:50598"
variation 3374
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="g"
/db_xref="dbSNP:2737827"
variation 3410
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11850"
variation 3450
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11549747"
variation 3477
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="c"
/replace="t"
/db_xref="dbSNP:10206"
variation 3561
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="g"
/db_xref="dbSNP:36123358"
polyA_signal 3605..3610
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
variation 3617
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="t"
/db_xref="dbSNP:3178056"
variation 3624
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
/replace="a"
/replace="t"
/db_xref="dbSNP:3178057"
polyA_site 3630
/gene="MCL1"
/gene_synonym="bcl2-L-3; BCL2L3; EAT; Mcl-1; MCL1-ES;
mcl1/EAT; MCL1L; MCL1S; TM"
ORIGIN
gcgcaaccctccggaagctgccgcccctttccccttttatgggaatactttttttaaaaaaaaagagttcgctggcgccaccccgtaggactggccgccctaaaaccgtgataaaggagctgctcgccacttctcacttccgcttccttccagtaaggagtcggggtcttccccagttttctcagccaggcggcggcggcgactggcaatgtttggcctcaaaagaaacgcggtaatcggactcaacctctactgtgggggggccggcttgggggccggcagcggcggcgccacccgcccgggagggcgacttttggccaccggcgccaaggacacaaagccaatgggcaggtctggggccaccagcaggaaggcgctggagaccttacgacgggttggggatggcgtgcagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaagacgatgtgaaatcgttgtctcgagtgatgatccatgttttcagcgacggcgtaacaaactggggcaggattgtgactctcatttcttttggtgcctttgtggctaaacacttgaagaccataaaccaagaaagctgcatcgaaccattagcagaaagtatcacagacgttctcgtaaggacaaaacgggactggctagttaaacaaagaggctgggatgggtttgtggagttcttccatgtagaggacctagaaggtggcatcaggaatgtgctgctggcttttgcaggtgttgctggagtaggagctggtttggcatatctaataagatagccttactgtaagtgcaatagttgacttttaaccaaccaccaccaccaccaaaaccagtttatgcagttggactccaagctgtaacttcctagagttgcaccctagcaacctagccagaaaagcaagtggcaagaggattatggctaacaagaataaatacatgggaagagtgctccccattgattgaagagtcactgtctgaaagaagcaaagttcagtttcagcaacaaacaaactttgtttgggaagctatggaggaggacttttagatttagtgaagatggtagggtggaaagacttaatttccttgttgagaacaggaaagtggccagtagccaggcaagtcatagaattgattacccgccgaattcattaatttactgtagtgttaagagaagcactaagaatgccagtgacctgtgtaaaagttacaagtaatagaactatgactgtaagcctcagtactgtacaagggaagcttttcctctctctaattagctttcccagtatacttcttagaaagtccaagtgttcaggacttttatacctgttatactttggcttggtttccatgattcttactttattagcctagtttatcaccaataatacttgacggaaggctcagtaattagttatgaatatggatatcctcaattcttaagacagcttgtaaatgtatttgtaaaaattgtatatatttttacagaaagtctatttctttgaaacgaaggaagtatcgaatttacattagtttttttcatacccttttgaactttgcaacttccgtaattaggaacctgtttcttacagcttttctatgctaaactttgttctgttcagttctagagtgtatacagaacgaattgatgtgtaactgtatgcagactggttgtagtggaacaaatctgataactatgcaggtttaaattttcttatctgattttggtaagtattccttagataggtttttctttgaaaacctgggattgagaggttgatgaatggaaattctttcacttcattatatgcaagttttcaataattaggtctaagtggagttttaaggttactgatgacttacaaataatgggctctgattgggcaatactcatttgagttccttccatttgacctaatttaactggtgaaatttaaagtgaattcatgggctcatctttaaagcttttactaaaagattttcagctgaatggaactcattagctgtgtgcatataaaaagatcacatcaggtggatggagagacatttgatcccttgtttgcttaataaattataaaatgatggcttggaaaagcaggctagtctaaccatggtgctattattaggcttgcttgttacacacacaggtctaagcctagtatgtcaataaagcaaatacttactgttttgtttctattaatgattcccaaaccttgttgcaagtttttgcattggcatctttggatttcagtcttgatgtttgttctatcagacttaaccttttatttcctgtccttccttgaaattgctgattgttctgctccctctacagatatttatatcaattcctacagctttcccctgccatccctgaactctttctagcccttttagattttggcactgtgaaacccctgctggaaacctgagtgaccctccctccccaccaagagtccacagacctttcatctttcacgaacttgatcctgttagcaggtggtaataccatgggtgctgtgacactaacagtcattgagaggtgggaggaagtcccttttccttggactggtatcttttcaactattgttttatcctgtctttgggggcaatgtgtcaaaagtcccctcaggaattttcagaggaaagaacattttatgaggctttctctaaagtttcctttgtataggagtatgctcacttaaatttacagaaagaggtgagctgtgttaaacctcagagtttaaaagctactgataaactgaagaaagtgtctatattggaactagggtcatttgaaagcttcagtctcggaacatgacctttagtctgtggactccatttaaaaataggtatgaataagatgactaagaatgtaatggggaagaactgccctgcctgcccatctcagagccataaggtcatctttgctagagctatttttacctatgtatttatcgttcttgatcataagccgcttatttatatcatgtatctctaaggacctaaaagcactttatgtagtttttaattaatcttaagatctggttacggtaactaaaaaagcctgtctgccaaatccagtggaaacaagtgcatagatgtgaattggtttttaggggccccacttcccaattcattaggtatgactgtggaaatacagacaaggatcttagttgatattttgggcttggggcagtgagggcttaggacaccccaagtggtttgggaaaggaggaggggagtggtgggtttatagggggaggaggaggcaggtggtctaagtgctgactggctacgtagttcgggcaaatcctccaaaagggaaagggaggatttgcttagaaggatggcgctcccagtgactactttttgacttctgtttgtcttacgcttctctcagggaaaaacatgcagtcctctagtgtttcatgtacattctgtggggggtgaacaccttggttctggttaaacagctgtacttttgatagctgtgccaggaagggttaggaccaactacaaattaatgttggttgtcaaatgtagtgtgtttccctaactttctgtttttcctgagaaaaaaaaataaatcttttattcaaatacagggaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:4170 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:4170 -> Molecular function: GO:0015266 [protein channel activity] evidence: TAS
GeneID:4170 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI
GeneID:4170 -> Molecular function: GO:0051434 [BH3 domain binding] evidence: IPI
GeneID:4170 -> Biological process: GO:0001709 [cell fate determination] evidence: NAS
GeneID:4170 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:4170 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA
GeneID:4170 -> Biological process: GO:0019725 [cellular homeostasis] evidence: NAS
GeneID:4170 -> Biological process: GO:0034097 [response to cytokine stimulus] evidence: IDA
GeneID:4170 -> Biological process: GO:0097194 [execution phase of apoptosis] evidence: IDA
GeneID:4170 -> Biological process: GO:1900118 [negative regulation of execution phase of apoptosis] evidence: TAS
GeneID:4170 -> Biological process: GO:2000811 [negative regulation of anoikis] evidence: IMP
GeneID:4170 -> Biological process: GO:2001020 [regulation of response to DNA damage stimulus] evidence: IMP
GeneID:4170 -> Biological process: GO:2001240 [negative regulation of extrinsic apoptotic signaling pathway in absence of ligand] evidence: IMP
GeneID:4170 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:4170 -> Cellular component: GO:0005654 [nucleoplasm] evidence: IEA
GeneID:4170 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
GeneID:4170 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:4170 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS
GeneID:4170 -> Cellular component: GO:0005759 [mitochondrial matrix] evidence: IEA
GeneID:4170 -> Cellular component: GO:0016020 [membrane] evidence: IDA
GeneID:4170 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
GeneID:4170 -> Cellular component: GO:0097136 [Bcl-2 family protein complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.