2024-04-26 08:10:41, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001197259 2488 bp mRNA linear PRI 15-JUN-2013 DEFINITION Homo sapiens origin recognition complex, subunit 3 (ORC3), transcript variant 3, mRNA. ACCESSION NM_001197259 VERSION NM_001197259.1 GI:308737002 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2488) AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K., Gibbs,R.A. and Butte,N.F. TITLE Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population JOURNAL PLoS ONE 7 (12), E51954 (2012) PUBMED 23251661 REFERENCE 2 (bases 1 to 2488) AUTHORS Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A. TITLE Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study JOURNAL Mutat. Res. 694 (1-2), 13-19 (2010) PUBMED 20800603 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 3 (bases 1 to 2488) AUTHORS Enjuanes,A., Benavente,Y., Bosch,F., Martin-Guerrero,I., Colomer,D., Perez-Alvarez,S., Reina,O., Ardanaz,M.T., Jares,P., Garcia-Orad,A., Pujana,M.A., Montserrat,E., de Sanjose,S. and Campo,E. TITLE Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia JOURNAL Cancer Res. 68 (24), 10178-10186 (2008) PUBMED 19074885 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 4 (bases 1 to 2488) AUTHORS DeRosse,P., Lencz,T., Burdick,K.E., Siris,S.G., Kane,J.M. and Malhotra,A.K. TITLE The genetics of symptom-based phenotypes: toward a molecular classification of schizophrenia JOURNAL Schizophr Bull 34 (6), 1047-1053 (2008) PUBMED 18628273 REMARK GeneRIF: Lifetime severity of positive symptoms was significantly (P = 2.50 x 10(-5)) associated with a SNP within the origin recognition complex subunit 3-like (ORC3L) gene, a gene implicated in synaptic plasticity. REFERENCE 5 (bases 1 to 2488) AUTHORS Siddiqui,K. and Stillman,B. TITLE ATP-dependent assembly of the human origin recognition complex JOURNAL J. Biol. Chem. 282 (44), 32370-32383 (2007) PUBMED 17716973 REFERENCE 6 (bases 1 to 2488) AUTHORS Izumi,M., Yanagi,K., Mizuno,T., Yokoi,M., Kawasaki,Y., Moon,K.Y., Hurwitz,J., Yatagai,F. and Hanaoka,F. TITLE The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase JOURNAL Nucleic Acids Res. 28 (23), 4769-4777 (2000) PUBMED 11095689 REFERENCE 7 (bases 1 to 2488) AUTHORS Thome,K.C., Dhar,S.K., Quintana,D.G., Delmolino,L., Shahsafaei,A. and Dutta,A. TITLE Subsets of human origin recognition complex (ORC) subunits are expressed in non-proliferating cells and associate with non-ORC proteins JOURNAL J. Biol. Chem. 275 (45), 35233-35241 (2000) PUBMED 10954718 REFERENCE 8 (bases 1 to 2488) AUTHORS Herbig,U., Marlar,C.A. and Fanning,E. TITLE The Cdc6 nucleotide-binding site regulates its activity in DNA replication in human cells JOURNAL Mol. Biol. Cell 10 (8), 2631-2645 (1999) PUBMED 10436018 REFERENCE 9 (bases 1 to 2488) AUTHORS Pinto,S., Quintana,D.G., Smith,P., Mihalek,R.M., Hou,Z.H., Boynton,S., Jones,C.J., Hendricks,M., Velinzon,K., Wohlschlegel,J.A., Austin,R.J., Lane,W.S., Tully,T. and Dutta,A. TITLE latheo encodes a subunit of the origin recognition complex and disrupts neuronal proliferation and adult olfactory memory when mutant JOURNAL Neuron 23 (1), 45-54 (1999) PUBMED 10402192 REMARK GeneRIF: Functional studies of the Drosophila homolog REFERENCE 10 (bases 1 to 2488) AUTHORS Tugal,T., Zou-Yang,X.H., Gavin,K., Pappin,D., Canas,B., Kobayashi,R., Hunt,T. and Stillman,B. TITLE The Orc4p and Orc5p subunits of the Xenopus and human origin recognition complex are related to Orc1p and Cdc6p JOURNAL J. Biol. Chem. 273 (49), 32421-32429 (1998) PUBMED 9829972 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DC395106.1, AK303195.1 and BM971022.1. Summary: The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Studies of a similar gene in Drosophila suggested a possible role of this protein in neuronal proliferation and olfactory memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (3) lacks an exon in the 5' coding region, resulting in a downstream AUG start codon, and also lacks three nts in an alternate splicing site in the 3' coding region, as compared to variant 1. The translation reading frame remains the same, and the resulting isoform (3) has a shorter N-terminus and lacks an internal aa, as compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK303195.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025086, ERS025091 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-76 DC395106.1 1-76 77-2189 AK303195.1 1-2113 2190-2488 BM971022.1 1-299 c FEATURES Location/Qualifiers source 1..2488 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6q14.3-q16.1" gene 1..2488 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /note="origin recognition complex, subunit 3" /db_xref="GeneID:23595" /db_xref="HGNC:8489" /db_xref="MIM:604972" exon 1..126 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 21 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:2307387" variation 35 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:146601654" variation 68 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:201438682" variation 88..89 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="" /replace="ag" /db_xref="dbSNP:28381461" variation 91..92 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="" /replace="gt" /db_xref="dbSNP:2307367" variation 101 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:2307368" variation 114 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:376418108" variation 116 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:375214415" variation 120 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:149941248" exon 127..181 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 159 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:201861328" variation 168 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:144122164" variation 178 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:148696846" misc_feature 179..181 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /note="upstream in-frame stop codon" exon 182..326 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 206 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:144040713" variation 245 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:78910923" variation 249 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:368053556" variation 258 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:371584444" variation 267 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:112186214" variation 280 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:74364970" variation 281 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:201924978" variation 284 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="c" /db_xref="dbSNP:2307365" variation 312 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:150252172" exon 327..431 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 331 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:145851270" variation 333 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="t" /db_xref="dbSNP:149010963" variation 359 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:373085430" variation 366 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:78632433" variation 367 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="c" /db_xref="dbSNP:143632999" variation 368 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:202154049" variation 381 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:2307371" variation 383 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:143881974" variation 391 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:369815671" variation 393 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:77689062" variation 409 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:373119034" variation 419 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:146526621" variation 423 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:141851921" exon 432..583 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" CDS 434..2140 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /note="isoform 3 is encoded by transcript variant 3; origin recognition complex, subunit 3 honolog; homolog of latheo, Drosophila; origin recognition complex subunit Latheo" /codon_start=1 /product="origin recognition complex subunit 3 isoform 3" /protein_id="NP_001184188.1" /db_xref="GI:308737003" /db_xref="CCDS:CCDS56440.1" /db_xref="GeneID:23595" /db_xref="HGNC:8489" /db_xref="MIM:604972" /translation="
MKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELRRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALHTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
" misc_feature <434..1036 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /note="Origin recognition complex (ORC) subunit 3 N-terminus; Region: ORC3_N; pfam07034" /db_xref="CDD:148572" variation 435 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:141721711" variation 472 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:150567304" variation 513 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:112741742" variation 515 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:61756140" variation 518 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:139602020" variation 552 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:149324991" variation 557..558 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="" /replace="c" /db_xref="dbSNP:35309297" exon 584..717 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 588 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:146286747" variation 589 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:369385539" variation 647 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:199698250" variation 653 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:2307389" variation 677 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:200682425" variation 683 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:199789475" variation 704 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:367552239" exon 718..877 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 743 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:2307374" variation 754 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:377330226" variation 786 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:146446780" variation 793 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:201301884" variation 814 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:367965463" variation 835 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:148643475" variation 864 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:2307381" variation 871 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:151302588" exon 878..991 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 951 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:140577831" variation 972 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="c" /db_xref="dbSNP:150481408" variation 991 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:2307363" exon 992..1125 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 998 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:61753612" variation 1014 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:147755470" variation 1036 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:368361212" variation 1067 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:200762592" exon 1126..1189 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1129 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:200082103" variation 1140 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="t" /db_xref="dbSNP:142333103" variation 1145 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:201077859" variation 1161 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:146416983" variation 1166 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:200211835" variation 1169 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="c" /db_xref="dbSNP:2307372" exon 1190..1306 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1191 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:376650812" variation 1197 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:371509958" variation 1280 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:138599697" exon 1307..1386 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1322 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:201209204" variation 1346 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:139108147" variation 1378 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:143108637" exon 1387..1520 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1395 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:371508516" variation 1403 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:148245971" variation 1446 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:9353493" variation 1455 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:202114121" variation 1496 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:2307393" variation 1510 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:201278306" variation 1512 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:146268634" exon 1521..1597 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1532 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:200525076" variation 1541 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:369225174" variation 1542 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:199578553" variation 1549 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:373490954" variation 1553 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:199748447" variation 1588 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:201594291" exon 1598..1695 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1599 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="c" /db_xref="dbSNP:138153363" variation 1658 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:142321378" exon 1696..1837 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1729 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:370934198" variation 1766 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:2307370" variation 1788 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:61747273" variation 1835 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:375586431" exon 1838..1954 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1856 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:370143904" variation 1863 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:139494209" STS 1872..2012 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /standard_name="STS-H99257" /db_xref="UniSTS:38099" variation 1880 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:28381545" variation 1884 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:201741907" variation 1909 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:144517793" exon 1955..2034 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 1955 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:374112561" variation 2003 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:148557057" variation 2032 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="c" /db_xref="dbSNP:200865515" exon 2035..2471 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /inference="alignment:Splign:1.39.8" variation 2040 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:188446659" STS 2051..2470 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /standard_name="ORC3L_9379" /db_xref="UniSTS:471702" variation 2096 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:146518052" STS 2102..2272 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /standard_name="RH68856" /db_xref="UniSTS:39128" variation 2165 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="g" /replace="t" /db_xref="dbSNP:376580990" variation 2171 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="c" /db_xref="dbSNP:368993527" variation 2180 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="t" /db_xref="dbSNP:371602431" variation 2223 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="g" /db_xref="dbSNP:2307380" variation 2241 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:190350143" variation 2245 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:2307392" variation 2282 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:2307369" variation 2328 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:149980633" variation 2348 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="c" /replace="t" /db_xref="dbSNP:28381552" variation 2352 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="t" /db_xref="dbSNP:145220662" polyA_signal 2441..2446 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" variation 2442 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:74984361" variation 2451 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" /replace="a" /replace="g" /db_xref="dbSNP:149159300" polyA_site 2471 /gene="ORC3" /gene_synonym="LAT; LATHEO; ORC3L" ORIGIN
caatcaaggagccgtgtggctcgccactaacctctgccctgcagccgcgagggcgcgcgggaaatcccgagtgcatctggaatacgcagagtcagtaagaccatggctacgtcctcgatgtctaagggttgctttgtttttaagccaaactccaaaaagagaaagatctctctgccaatagcgactacaagaggaattaaataaaaacttgtttgacaatctgattgaatttctgcaaaaatcacattctggattccagaagaattcaagagacttgggcggtcaaataaaactcagagaaattccaactgctgctcttgttcttggtgtgaatgtcacagatcatgatttgacattcggaagtctaacagaggcccttcagaataatgtcacaccatatgtagtctcattgcaagctaaagattgtccagatatgaaacattttttgcaaaagttgatctcacagttgatggactgctgtgtagatataaaatccaaagaggaggaaagtgttcacgtcacccaaagaaagacacattattcaatggattcactttccagttggtatatgactgtcacacagaagacggacccaaaaatgctaagcaaaaaaaggactacttctagccaatggcagtctcctcctgttgtcgttatcttgaaggatatggaaagctttgccacaaaagtactacaagacttcataattatcagcagtcaacatctccatgaatttccactaatactcatttttggaatagccacatctcctattatcatccaccgattgcttcctcatgcagtatcatctctattgtgcatagaactgttccaatctttgtcttgtaaggagcacctgactacggtactcgataagctacttcttacaactcagtttccctttaaaataaatgaaaaagtattacaggttctgaccaacatctttttgtatcatgatttctcagttcaaaactttataaaaggacttcagctttctctattagagcatttctattcccagcccttaagtgtcctgtgctgtaatcttccagaagccaaaagaagaataaattttttatcaaataatcaatgtgaaaacatccgacgtctaccatcttttaggaggtacgtggaaaagcaagcttcagaaaagcaagttgcgctcttgaccaatgagagatatttgaaggaggaaacacaattattactagaaaacctgcatgtttatcatatgaattacttcctggttttgagatgtcttcataagttcacctcttctcttcccaagtatccactaggtcgacagatcagagagttgtactgtacatgtttagaaaagaacatatgggattcagaggagtatgcatcagtcttgcagctgctgaggatgttggcaaaggatgaactgatgaccatacttgagaaatgtttcaaggtttttaagtcttattgtgaaaaccaccttggcagcacagctaagagaatagaggagttcctggcccagtttcagagcctcgatgaaaccaaagaggaagaagatgcttctgggtcacagccaaaggggcttcagaagacagacctctatcatcttcagaagtccttattggaaatgaaggagttaagaagaagtaagaagcaaaccaaatttgaagtactcagagaaaatgttgtgaacttcattgactgtctagtgagagaataccttctgcctcctgagacacagcctctccatgaggtggtgtacttcagtgctgcccatgcccttcgtgagcatttaaatgctgctccgcgaattgccctccatactgcactcaacaatccttactattatctcaagaatgaagcactgaaaagcgaagaaggctgcattccgaatatcgccccagacatctgcatagcatacaaactgcacctagagtgtagcaggctcatcaacctcgtggactggtcagaggcttttgcaacagttgtgacagctgctgaaaaaatggatgcaaattctgcaacctcagaagaaatgaatgaaattatccatgctcggtttattagagctgtttctgaactagaacttttaggatttataaaacctaccaaacagaagactgaccatgtggcaagactaacatggggaggctgctagaaagcaaataagcaaagccagaactatcacatttagcttaagagaaaaaggtgaccagtcatatttacatatattagaggagcctgttttgttgagaagataaatgtgtaacccccattgatgtttaaccagaaaagtacattgctaaccccaaacaggcatgtatcaaaacacctgtggagtactttagactccaacaaataataatgtaactaaaactgctcacacattttactgtactttccaaagtcattactaaattgtgagtaaatcattcttgaacttagagtatgtaaatgtaataaattccgttatccaggagtataaattaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:23595 -> Molecular function: GO:0003688 [DNA replication origin binding] evidence: TAS GeneID:23595 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:23595 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS GeneID:23595 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS GeneID:23595 -> Biological process: GO:0006260 [DNA replication] evidence: TAS GeneID:23595 -> Cellular component: GO:0000808 [origin recognition complex] evidence: IDA GeneID:23595 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:23595 -> Cellular component: GO:0005664 [nuclear origin of replication recognition complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.