GGRNA Home | Help | Advanced search

2020-10-24 07:09:28, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001197259            2488 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens origin recognition complex, subunit 3 (ORC3),
            transcript variant 3, mRNA.
ACCESSION   NM_001197259
VERSION     NM_001197259.1  GI:308737002
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2488)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   2  (bases 1 to 2488)
  AUTHORS   Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H.,
            Schreiber,S. and Nebel,A.
  TITLE     Investigation of genetic susceptibility factors for human longevity
            - a targeted nonsynonymous SNP study
  JOURNAL   Mutat. Res. 694 (1-2), 13-19 (2010)
   PUBMED   20800603
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 2488)
  AUTHORS   Enjuanes,A., Benavente,Y., Bosch,F., Martin-Guerrero,I.,
            Colomer,D., Perez-Alvarez,S., Reina,O., Ardanaz,M.T., Jares,P.,
            Garcia-Orad,A., Pujana,M.A., Montserrat,E., de Sanjose,S. and
            Campo,E.
  TITLE     Genetic variants in apoptosis and immunoregulation-related genes
            are associated with risk of chronic lymphocytic leukemia
  JOURNAL   Cancer Res. 68 (24), 10178-10186 (2008)
   PUBMED   19074885
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 2488)
  AUTHORS   DeRosse,P., Lencz,T., Burdick,K.E., Siris,S.G., Kane,J.M. and
            Malhotra,A.K.
  TITLE     The genetics of symptom-based phenotypes: toward a molecular
            classification of schizophrenia
  JOURNAL   Schizophr Bull 34 (6), 1047-1053 (2008)
   PUBMED   18628273
  REMARK    GeneRIF: Lifetime severity of positive symptoms was significantly
            (P = 2.50 x 10(-5)) associated with a SNP within the origin
            recognition complex subunit 3-like (ORC3L) gene, a gene implicated
            in synaptic plasticity.
REFERENCE   5  (bases 1 to 2488)
  AUTHORS   Siddiqui,K. and Stillman,B.
  TITLE     ATP-dependent assembly of the human origin recognition complex
  JOURNAL   J. Biol. Chem. 282 (44), 32370-32383 (2007)
   PUBMED   17716973
REFERENCE   6  (bases 1 to 2488)
  AUTHORS   Izumi,M., Yanagi,K., Mizuno,T., Yokoi,M., Kawasaki,Y., Moon,K.Y.,
            Hurwitz,J., Yatagai,F. and Hanaoka,F.
  TITLE     The human homolog of Saccharomyces cerevisiae Mcm10 interacts with
            replication factors and dissociates from nuclease-resistant nuclear
            structures in G(2) phase
  JOURNAL   Nucleic Acids Res. 28 (23), 4769-4777 (2000)
   PUBMED   11095689
REFERENCE   7  (bases 1 to 2488)
  AUTHORS   Thome,K.C., Dhar,S.K., Quintana,D.G., Delmolino,L., Shahsafaei,A.
            and Dutta,A.
  TITLE     Subsets of human origin recognition complex (ORC) subunits are
            expressed in non-proliferating cells and associate with non-ORC
            proteins
  JOURNAL   J. Biol. Chem. 275 (45), 35233-35241 (2000)
   PUBMED   10954718
REFERENCE   8  (bases 1 to 2488)
  AUTHORS   Herbig,U., Marlar,C.A. and Fanning,E.
  TITLE     The Cdc6 nucleotide-binding site regulates its activity in DNA
            replication in human cells
  JOURNAL   Mol. Biol. Cell 10 (8), 2631-2645 (1999)
   PUBMED   10436018
REFERENCE   9  (bases 1 to 2488)
  AUTHORS   Pinto,S., Quintana,D.G., Smith,P., Mihalek,R.M., Hou,Z.H.,
            Boynton,S., Jones,C.J., Hendricks,M., Velinzon,K.,
            Wohlschlegel,J.A., Austin,R.J., Lane,W.S., Tully,T. and Dutta,A.
  TITLE     latheo encodes a subunit of the origin recognition complex and
            disrupts neuronal proliferation and adult olfactory memory when
            mutant
  JOURNAL   Neuron 23 (1), 45-54 (1999)
   PUBMED   10402192
  REMARK    GeneRIF: Functional studies of the Drosophila homolog
REFERENCE   10 (bases 1 to 2488)
  AUTHORS   Tugal,T., Zou-Yang,X.H., Gavin,K., Pappin,D., Canas,B.,
            Kobayashi,R., Hunt,T. and Stillman,B.
  TITLE     The Orc4p and Orc5p subunits of the Xenopus and human origin
            recognition complex are related to Orc1p and Cdc6p
  JOURNAL   J. Biol. Chem. 273 (49), 32421-32429 (1998)
   PUBMED   9829972
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC395106.1, AK303195.1 and
            BM971022.1.
            
            Summary: The origin recognition complex (ORC) is a highly conserved
            six subunits protein complex essential for the initiation of the
            DNA replication in eukaryotic cells. Studies in yeast demonstrated
            that ORC binds specifically to origins of replication and serves as
            a platform for the assembly of additional initiation factors such
            as Cdc6 and Mcm proteins. The protein encoded by this gene is a
            subunit of the ORC complex. Studies of a similar gene in Drosophila
            suggested a possible role of this protein in neuronal proliferation
            and olfactory memory. Alternatively spliced transcript variants
            encoding distinct isoforms have been reported for this gene.
            [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (3) lacks an exon in the 5' coding
            region, resulting in a downstream AUG start codon, and also lacks
            three nts in an alternate splicing site in the 3' coding region, as
            compared to variant 1. The translation reading frame remains the
            same, and the resulting isoform (3) has a shorter N-terminus and
            lacks an internal aa, as compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK303195.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025086, ERS025091 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-76                DC395106.1         1-76
            77-2189             AK303195.1         1-2113
            2190-2488           BM971022.1         1-299               c
FEATURES             Location/Qualifiers
     source          1..2488
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6q14.3-q16.1"
     gene            1..2488
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /note="origin recognition complex, subunit 3"
                     /db_xref="GeneID:23595"
                     /db_xref="HGNC:8489"
                     /db_xref="MIM:604972"
     exon            1..126
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       21
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2307387"
     variation       35
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146601654"
     variation       68
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201438682"
     variation       88..89
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:28381461"
     variation       91..92
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace=""
                     /replace="gt"
                     /db_xref="dbSNP:2307367"
     variation       101
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2307368"
     variation       114
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376418108"
     variation       116
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375214415"
     variation       120
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149941248"
     exon            127..181
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       159
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201861328"
     variation       168
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144122164"
     variation       178
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148696846"
     misc_feature    179..181
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /note="upstream in-frame stop codon"
     exon            182..326
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       206
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144040713"
     variation       245
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:78910923"
     variation       249
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368053556"
     variation       258
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371584444"
     variation       267
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112186214"
     variation       280
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74364970"
     variation       281
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201924978"
     variation       284
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2307365"
     variation       312
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150252172"
     exon            327..431
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       331
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145851270"
     variation       333
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:149010963"
     variation       359
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373085430"
     variation       366
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78632433"
     variation       367
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:143632999"
     variation       368
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202154049"
     variation       381
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2307371"
     variation       383
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143881974"
     variation       391
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369815671"
     variation       393
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77689062"
     variation       409
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373119034"
     variation       419
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146526621"
     variation       423
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141851921"
     exon            432..583
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     CDS             434..2140
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /note="isoform 3 is encoded by transcript variant 3;
                     origin recognition complex, subunit 3 honolog; homolog of
                     latheo, Drosophila; origin recognition complex subunit
                     Latheo"
                     /codon_start=1
                     /product="origin recognition complex subunit 3 isoform 3"
                     /protein_id="NP_001184188.1"
                     /db_xref="GI:308737003"
                     /db_xref="CCDS:CCDS56440.1"
                     /db_xref="GeneID:23595"
                     /db_xref="HGNC:8489"
                     /db_xref="MIM:604972"
                     /translation="
MKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSNNQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELRRSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALHTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
"
     misc_feature    <434..1036
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /note="Origin recognition complex (ORC) subunit 3
                     N-terminus; Region: ORC3_N; pfam07034"
                     /db_xref="CDD:148572"
     variation       435
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141721711"
     variation       472
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150567304"
     variation       513
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112741742"
     variation       515
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61756140"
     variation       518
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139602020"
     variation       552
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149324991"
     variation       557..558
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35309297"
     exon            584..717
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       588
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146286747"
     variation       589
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369385539"
     variation       647
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199698250"
     variation       653
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2307389"
     variation       677
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200682425"
     variation       683
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199789475"
     variation       704
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367552239"
     exon            718..877
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       743
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2307374"
     variation       754
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377330226"
     variation       786
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146446780"
     variation       793
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201301884"
     variation       814
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367965463"
     variation       835
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148643475"
     variation       864
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2307381"
     variation       871
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151302588"
     exon            878..991
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       951
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140577831"
     variation       972
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150481408"
     variation       991
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2307363"
     exon            992..1125
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       998
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61753612"
     variation       1014
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147755470"
     variation       1036
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368361212"
     variation       1067
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200762592"
     exon            1126..1189
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1129
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200082103"
     variation       1140
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142333103"
     variation       1145
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201077859"
     variation       1161
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146416983"
     variation       1166
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200211835"
     variation       1169
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2307372"
     exon            1190..1306
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1191
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376650812"
     variation       1197
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371509958"
     variation       1280
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138599697"
     exon            1307..1386
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1322
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201209204"
     variation       1346
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139108147"
     variation       1378
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143108637"
     exon            1387..1520
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1395
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371508516"
     variation       1403
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148245971"
     variation       1446
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9353493"
     variation       1455
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202114121"
     variation       1496
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2307393"
     variation       1510
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201278306"
     variation       1512
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146268634"
     exon            1521..1597
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1532
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200525076"
     variation       1541
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369225174"
     variation       1542
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199578553"
     variation       1549
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373490954"
     variation       1553
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199748447"
     variation       1588
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201594291"
     exon            1598..1695
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1599
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138153363"
     variation       1658
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142321378"
     exon            1696..1837
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1729
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370934198"
     variation       1766
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2307370"
     variation       1788
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61747273"
     variation       1835
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375586431"
     exon            1838..1954
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1856
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370143904"
     variation       1863
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139494209"
     STS             1872..2012
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /standard_name="STS-H99257"
                     /db_xref="UniSTS:38099"
     variation       1880
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28381545"
     variation       1884
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201741907"
     variation       1909
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144517793"
     exon            1955..2034
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       1955
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374112561"
     variation       2003
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148557057"
     variation       2032
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200865515"
     exon            2035..2471
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /inference="alignment:Splign:1.39.8"
     variation       2040
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188446659"
     STS             2051..2470
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /standard_name="ORC3L_9379"
                     /db_xref="UniSTS:471702"
     variation       2096
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146518052"
     STS             2102..2272
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /standard_name="RH68856"
                     /db_xref="UniSTS:39128"
     variation       2165
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376580990"
     variation       2171
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368993527"
     variation       2180
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371602431"
     variation       2223
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2307380"
     variation       2241
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190350143"
     variation       2245
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2307392"
     variation       2282
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2307369"
     variation       2328
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149980633"
     variation       2348
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:28381552"
     variation       2352
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145220662"
     polyA_signal    2441..2446
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
     variation       2442
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74984361"
     variation       2451
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149159300"
     polyA_site      2471
                     /gene="ORC3"
                     /gene_synonym="LAT; LATHEO; ORC3L"
ORIGIN      
caatcaaggagccgtgtggctcgccactaacctctgccctgcagccgcgagggcgcgcgggaaatcccgagtgcatctggaatacgcagagtcagtaagaccatggctacgtcctcgatgtctaagggttgctttgtttttaagccaaactccaaaaagagaaagatctctctgccaatagcgactacaagaggaattaaataaaaacttgtttgacaatctgattgaatttctgcaaaaatcacattctggattccagaagaattcaagagacttgggcggtcaaataaaactcagagaaattccaactgctgctcttgttcttggtgtgaatgtcacagatcatgatttgacattcggaagtctaacagaggcccttcagaataatgtcacaccatatgtagtctcattgcaagctaaagattgtccagatatgaaacattttttgcaaaagttgatctcacagttgatggactgctgtgtagatataaaatccaaagaggaggaaagtgttcacgtcacccaaagaaagacacattattcaatggattcactttccagttggtatatgactgtcacacagaagacggacccaaaaatgctaagcaaaaaaaggactacttctagccaatggcagtctcctcctgttgtcgttatcttgaaggatatggaaagctttgccacaaaagtactacaagacttcataattatcagcagtcaacatctccatgaatttccactaatactcatttttggaatagccacatctcctattatcatccaccgattgcttcctcatgcagtatcatctctattgtgcatagaactgttccaatctttgtcttgtaaggagcacctgactacggtactcgataagctacttcttacaactcagtttccctttaaaataaatgaaaaagtattacaggttctgaccaacatctttttgtatcatgatttctcagttcaaaactttataaaaggacttcagctttctctattagagcatttctattcccagcccttaagtgtcctgtgctgtaatcttccagaagccaaaagaagaataaattttttatcaaataatcaatgtgaaaacatccgacgtctaccatcttttaggaggtacgtggaaaagcaagcttcagaaaagcaagttgcgctcttgaccaatgagagatatttgaaggaggaaacacaattattactagaaaacctgcatgtttatcatatgaattacttcctggttttgagatgtcttcataagttcacctcttctcttcccaagtatccactaggtcgacagatcagagagttgtactgtacatgtttagaaaagaacatatgggattcagaggagtatgcatcagtcttgcagctgctgaggatgttggcaaaggatgaactgatgaccatacttgagaaatgtttcaaggtttttaagtcttattgtgaaaaccaccttggcagcacagctaagagaatagaggagttcctggcccagtttcagagcctcgatgaaaccaaagaggaagaagatgcttctgggtcacagccaaaggggcttcagaagacagacctctatcatcttcagaagtccttattggaaatgaaggagttaagaagaagtaagaagcaaaccaaatttgaagtactcagagaaaatgttgtgaacttcattgactgtctagtgagagaataccttctgcctcctgagacacagcctctccatgaggtggtgtacttcagtgctgcccatgcccttcgtgagcatttaaatgctgctccgcgaattgccctccatactgcactcaacaatccttactattatctcaagaatgaagcactgaaaagcgaagaaggctgcattccgaatatcgccccagacatctgcatagcatacaaactgcacctagagtgtagcaggctcatcaacctcgtggactggtcagaggcttttgcaacagttgtgacagctgctgaaaaaatggatgcaaattctgcaacctcagaagaaatgaatgaaattatccatgctcggtttattagagctgtttctgaactagaacttttaggatttataaaacctaccaaacagaagactgaccatgtggcaagactaacatggggaggctgctagaaagcaaataagcaaagccagaactatcacatttagcttaagagaaaaaggtgaccagtcatatttacatatattagaggagcctgttttgttgagaagataaatgtgtaacccccattgatgtttaaccagaaaagtacattgctaaccccaaacaggcatgtatcaaaacacctgtggagtactttagactccaacaaataataatgtaactaaaactgctcacacattttactgtactttccaaagtcattactaaattgtgagtaaatcattcttgaacttagagtatgtaaatgtaataaattccgttatccaggagtataaattaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:23595 -> Molecular function: GO:0003688 [DNA replication origin binding] evidence: TAS
            GeneID:23595 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:23595 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
            GeneID:23595 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
            GeneID:23595 -> Biological process: GO:0006260 [DNA replication] evidence: TAS
            GeneID:23595 -> Cellular component: GO:0000808 [origin recognition complex] evidence: IDA
            GeneID:23595 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
            GeneID:23595 -> Cellular component: GO:0005664 [nuclear origin of replication recognition complex] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.