GGRNA Home | Help | Advanced search

2019-03-25 15:07:05, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001195432            2538 bp    mRNA    linear   PRI 02-JUN-2013
DEFINITION  Homo sapiens myeloid leukemia factor 1 (MLF1), transcript variant
            4, mRNA.
ACCESSION   NM_001195432
VERSION     NM_001195432.1  GI:306482664
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2538)
  AUTHORS   Molzan,M. and Ottmann,C.
  TITLE     Subcellular localization of full-length human myeloid leukemia
            factor 1 (MLF1) is independent of 14-3-3 proteins
  JOURNAL   Cell. Mol. Biol. Lett. 18 (1), 137-148 (2013)
   PUBMED   23271436
  REMARK    GeneRIF: The subcellular localization of full-length human MLF1 is
            14-3-3epsilon-independent.
REFERENCE   2  (bases 1 to 2538)
  AUTHORS   Lee,W.H., Salek-Ardakani,S., Pandolfi,P.P., Brady,H.J., de Boer,J.
            and Williams,O.
  TITLE     NPM-MLF1 synergizes with Npm haploinsufficiency to enhance myeloid
            progenitor activity
  JOURNAL   Leukemia 26 (5), 1110-1112 (2012)
   PUBMED   22193965
  REMARK    GeneRIF: changes in the subcellular localization of NPM, due to
            alterations in the relative abundance of NPM and NPM-MLF1 proteins,
            may contribute to the enhanced myeloid progenitor activity of Npm
            +/- cells
REFERENCE   3  (bases 1 to 2538)
  AUTHORS   Molzan,M., Weyand,M., Rose,R. and Ottmann,C.
  TITLE     Structural insights of the MLF1/14-3-3 interaction
  JOURNAL   FEBS J. 279 (4), 563-571 (2012)
   PUBMED   22151054
  REMARK    GeneRIF: Data present the high-resolution crystal structure of this
            binding motif [MLF1(29-42)pSer34] in complex with 14-3-3epsilon and
            analyse the interaction with isothermal titration calorimetry.
REFERENCE   4  (bases 1 to 2538)
  AUTHORS   Lim,G., Choi,J.R., Kim,M.J., Kim,S.Y., Lee,H.J., Suh,J.T.,
            Yoon,H.J., Lee,J., Lee,S., Lee,W.I. and Park,T.S.
  TITLE     Detection of t(3;5) and NPM1/MLF1 rearrangement in an elderly
            patient with acute myeloid leukemia: clinical and laboratory study
            with review of the literature
  JOURNAL   Cancer Genet. Cytogenet. 199 (2), 101-109 (2010)
   PUBMED   20471513
  REMARK    GeneRIF: MLF1 gene rearrangement is associated with acute myeloid
            leukemia.
            Review article
REFERENCE   5  (bases 1 to 2538)
  AUTHORS   Luke,M.M., O'Meara,E.S., Rowland,C.M., Shiffman,D., Bare,L.A.,
            Arellano,A.R., Longstreth,W.T. Jr., Lumley,T., Rice,K., Tracy,R.P.,
            Devlin,J.J. and Psaty,B.M.
  TITLE     Gene variants associated with ischemic stroke: the cardiovascular
            health study
  JOURNAL   Stroke 40 (2), 363-368 (2009)
   PUBMED   19023099
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   6  (bases 1 to 2538)
  AUTHORS   Yoneda-Kato,N., Tomoda,K., Umehara,M., Arata,Y. and Kato,J.Y.
  TITLE     Myeloid leukemia factor 1 regulates p53 by suppressing COP1 via
            COP9 signalosome subunit 3
  JOURNAL   EMBO J. 24 (9), 1739-1749 (2005)
   PUBMED   15861129
REFERENCE   7  (bases 1 to 2538)
  AUTHORS   Hanissian,S.H., Akbar,U., Teng,B., Janjetovic,Z., Hoffmann,A.,
            Hitzler,J.K., Iscove,N., Hamre,K., Du,X., Tong,Y., Mukatira,S.,
            Robertson,J.H. and Morris,S.W.
  TITLE     cDNA cloning and characterization of a novel gene encoding the
            MLF1-interacting protein MLF1IP
  JOURNAL   Oncogene 23 (20), 3700-3707 (2004)
   PUBMED   15116101
REFERENCE   8  (bases 1 to 2538)
  AUTHORS   Arber,D.A., Chang,K.L., Lyda,M.H., Bedell,V., Spielberger,R. and
            Slovak,M.L.
  TITLE     Detection of NPM/MLF1 fusion in t(3;5)-positive acute myeloid
            leukemia and myelodysplasia
  JOURNAL   Hum. Pathol. 34 (8), 809-813 (2003)
   PUBMED   14506644
  REMARK    GeneRIF: These findings suggest that an NPM/MLF1 fusion is the
            primary molecular abnormality in t(3;5) MDS and AML with
            multilineage dysplasia, and that cases with NPM/MLF1 may be
            clinically distinct from other MDS-associated disease
REFERENCE   9  (bases 1 to 2538)
  AUTHORS   Lim,R., Winteringham,L.N., Williams,J.H., McCulloch,R.K.,
            Ingley,E., Tiao,J.Y., Lalonde,J.P., Tsai,S., Tilbrook,P.A., Sun,Y.,
            Wu,X., Morris,S.W. and Klinken,S.P.
  TITLE     MADM, a novel adaptor protein that mediates phosphorylation of the
            14-3-3 binding site of myeloid leukemia factor 1
  JOURNAL   J. Biol. Chem. 277 (43), 40997-41008 (2002)
   PUBMED   12176995
  REMARK    GeneRIF: phosphorylation of 14-3-3 binding site by MADM
REFERENCE   10 (bases 1 to 2538)
  AUTHORS   Yoneda-Kato,N., Look,A.T., Kirstein,M.N., Valentine,M.B.,
            Raimondi,S.C., Cohen,K.J., Carroll,A.J. and Morris,S.W.
  TITLE     The t(3;5)(q25.1;q34) of myelodysplastic syndrome and acute myeloid
            leukemia produces a novel fusion gene, NPM-MLF1
  JOURNAL   Oncogene 12 (2), 265-275 (1996)
   PUBMED   8570204
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DB455518.1, AK096889.1,
            AC025033.20, BX647666.1 and BU619178.1.
            This sequence is a reference standard in the RefSeqGene project.
            
            Summary: This gene encodes an oncoprotein which is thought to play
            a role in the phenotypic determination of hemopoetic cells.
            Translocations between this gene and nucleophosmin have been
            associated with myelodysplastic syndrome and acute myeloid
            leukemia. Multiple transcript variants encoding different isoforms
            have been found for this gene. [provided by RefSeq, Sep 2010].
            
            Transcript Variant: This variant (4) represents the longest
            transcript and encodes the longest isoform (3).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK096889.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-90                DB455518.1         1-90
            91-322              AK096889.1         1-232
            323-359             AC025033.20        85281-85317         c
            360-1462            AK096889.1         269-1371
            1463-2517           BX647666.1         1199-2253
            2518-2538           BU619178.1         1-21                c
FEATURES             Location/Qualifiers
     source          1..2538
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3q25.1"
     gene            1..2538
                     /gene="MLF1"
                     /note="myeloid leukemia factor 1"
                     /db_xref="GeneID:4291"
                     /db_xref="HGNC:7125"
                     /db_xref="MIM:601402"
     exon            1..184
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       43
                     /gene="MLF1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369380572"
     variation       57
                     /gene="MLF1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143695805"
     variation       83
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3817373"
     variation       86
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376950316"
     variation       108
                     /gene="MLF1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:375504173"
     variation       116
                     /gene="MLF1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:115990924"
     variation       126
                     /gene="MLF1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368308808"
     variation       139
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145269202"
     variation       169
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111765288"
     exon            185..458
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       236..237
                     /gene="MLF1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:367962940"
     misc_feature    301..303
                     /gene="MLF1"
                     /note="upstream in-frame stop codon"
     variation       345
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182805973"
     CDS             364..1263
                     /gene="MLF1"
                     /note="isoform 3 is encoded by transcript variant 4;
                     myelodysplasia-myeloid leukemia factor 1"
                     /codon_start=1
                     /product="myeloid leukemia factor 1 isoform 3"
                     /protein_id="NP_001182361.1"
                     /db_xref="GI:306482665"
                     /db_xref="CCDS:CCDS56286.1"
                     /db_xref="GeneID:4291"
                     /db_xref="HGNC:7125"
                     /db_xref="MIM:601402"
                     /translation="
MLKEVLQREGKSYKSETLMYIKKARASENKLSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTATSCSLVPFGDFGGMHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK
"
     misc_feature    487..1065
                     /gene="MLF1"
                     /note="Myelodysplasia-myeloid leukemia factor
                     1-interacting protein; Region: Mlf1IP; pfam10248"
                     /db_xref="CDD:118772"
     exon            459..606
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       478
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141212572"
     variation       484
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368107623"
     variation       488
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371659390"
     variation       490
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375897249"
     variation       530
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11553990"
     variation       572
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200582831"
     variation       589
                     /gene="MLF1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143826689"
     variation       595
                     /gene="MLF1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138730214"
     variation       596
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11553991"
     exon            607..651
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       611
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371041058"
     variation       637
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377002058"
     exon            652..735
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       679
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373208111"
     variation       683
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34136180"
     variation       690
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35009328"
     variation       718
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11553992"
     variation       722
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148038875"
     exon            736..864
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       736
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369492661"
     variation       737
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141753552"
     variation       758
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376983899"
     variation       809
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370155653"
     variation       815
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199951975"
     variation       821
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:202204704"
     variation       837
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143366875"
     variation       851
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201952489"
     exon            865..1024
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       866
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371177089"
     variation       883
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73024716"
     variation       887
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201416644"
     variation       951
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142693175"
     variation       1011
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78816147"
     exon            1025..1157
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       1026
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4875"
     variation       1027
                     /gene="MLF1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201104179"
     variation       1043
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185859110"
     variation       1067
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144857882"
     variation       1068
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148554013"
     variation       1103
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368269871"
     variation       1112
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142947056"
     variation       1132
                     /gene="MLF1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:15967"
     variation       1141
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200248107"
     exon            1158..2521
                     /gene="MLF1"
                     /inference="alignment:Splign:1.39.8"
     variation       1206
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:141302132"
     STS             1261..1436
                     /gene="MLF1"
                     /standard_name="SHGC-35682"
                     /db_xref="UniSTS:60298"
     variation       1268
                     /gene="MLF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199617681"
     variation       1293
                     /gene="MLF1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370819280"
     STS             1296..1428
                     /gene="MLF1"
                     /standard_name="STS-L49054"
                     /db_xref="UniSTS:76082"
     variation       1297
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373841165"
     variation       1340
                     /gene="MLF1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:191163198"
     variation       1459
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373936354"
     variation       1484
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6804259"
     variation       1734
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182535822"
     variation       1904
                     /gene="MLF1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187657148"
     variation       1937
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7628293"
     variation       1988
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:7617983"
     variation       2058..2059
                     /gene="MLF1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35709400"
     variation       2082
                     /gene="MLF1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372252684"
     STS             2159..2348
                     /gene="MLF1"
                     /standard_name="RH102628"
                     /db_xref="UniSTS:96962"
     variation       2295
                     /gene="MLF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34245841"
     variation       2322
                     /gene="MLF1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:16829134"
     polyA_signal    2497..2502
                     /gene="MLF1"
     polyA_site      2520
                     /gene="MLF1"
ORIGIN      
tatcccggcgggcaccgcctgcgccgcggcgagtgaggcgtcgtccgtactggaggctagctcttgtcgcggccgcggcgagttaacatcgtttttccaatctgtccgcggctgccgccacccaagacagagccagaatgttcaggatgctgaacagcagttttgaggatgaccccttcttctcagaccatgcaagcaagaagagaatggcatgaaatatataaagtgttgagaggaaaaaaacccactgacctagaattctgtatcctgcaaaattatcctttaaaagtcaagaagaaatagactgtctcagacaaacaaaaatttggtgaatttgttgacagtagacctgccttgcaagaaatgttaaaagaagttcttcagagagaaggaaaatcatacaagtcagaaactctgatgtacattaaaaaagcaagagcatcagagaataagttaagtgagtccattcttgcacaccgagaaaatatgcgacagatgataagaagtttttctgaaccctttggaagagacttgctcagtatctctgatggtagagggagagctcataatcgtagaggacataatgatggtgaagattctttgactgcaacgagttgttctcttgtgccttttggcgattttggtggtatgcatacagatgtcagctctttccagacaatggaccaaatggtgtcaaatatgagaaactatatgcagaaattagaaagaaacttcggtcaactttcagtggatccaaatggacattcattttgttcttcctcagttatgacttattccaaaataggagatgaaccgccaaaggtttttcaggcctcaactcaaactcgtcgagctccaggaggaataaaggaaaccaggaaagcaatgagagattctgacagtggactagaaaaaatggctattggtcatcatatccatgaccgagctcatgtcattaaaaagtcaaagaacaagaagactggagatgaagaggtcaaccaggagttcatcaatatgaatgaaagtgatgctcatgcttttgatgaggagtggcaaagtgaggttttgaagtacaaaccaggacgacacaatctaggaaacactagaatgagaagtgttggccatgagaatcctggctcccgagaacttaaaagaagggagaaacctcaacaaagtccagccattgaacatggaaggagatcaaatgttttgggggacaaactccacatcaaaggctcatctgtgaaaagcaacaaaaaataaatagccatgcatttgatttgtttagttttgattgttttaacagttagtaatggtgctgggtaataagcataagaccaatctcttgctgttaaatcagttctgtccttggcaactttcttctgatatctgaatgttcatgaaggtcctagctttatattgtccctcttttaggaataaaattttgattttcaacaatgtgagtaaattgagtctatttaatgtaaaactctttaaaacatactaattttttaaagcttatatgcttatttcgcttccccagttgtttttgtgttggctaaatattcttttatatttatcaagattgattgcagagcagttctatcacttataattagttataagaaattataatgttaaaaaagtctcagtttttactaacactgtactagggtgatattaataaaggtttaaataatttatctctaattttataatgtgttgtaaagccaactagcttaaaactttaaaaataataaagcaaaactacactagtactcttttatgagaaaatagttactattttgataaagggcaaggataatcaaatagttcattttcagagaaaaatattttaaattgctaatgtacatgattgttttggttataatttatttatagaatgtatcttttctatattacattcttaatattcaccagatattatattgaccattctctttaacttcttaatgtggcatatttctactctcctttcccacaaacagcttcatctgtctccaaggttaacattctgaagctggagagtccttggagaaactctgctcagcttttttgtgacatttagaaaaatgcatttggtattctccaaaccagaatgatacattgtctcaaaatctgttagacagctgatgggtgtttttgagcaacgtcttaataattcagttgtttctgttttaattataccattaaaaatcagctttagctttttaattctagaatttaagcatcagtctgttcttataaaagttaggtttgaagtttataagaatataaaatcttaactcacatttgttgtttaatatttctgtcaaggaaaaaagcccccaaaaattgctatcactctataatcctaagtatttttcttttcaattttgtaagtaaaattatatgactatgttcatacttctctaattttttatataatatttttgttaattttactagtttgtgttttatgcctttagtcattaaaataaaatgcaaatgtgttaattcaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:4291 -> Molecular function: GO:0003677 [DNA binding] evidence: ISS
            GeneID:4291 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:4291 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IDA
            GeneID:4291 -> Biological process: GO:0002318 [myeloid progenitor cell differentiation] evidence: ISS
            GeneID:4291 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: ISS
            GeneID:4291 -> Biological process: GO:0007050 [cell cycle arrest] evidence: IDA
            GeneID:4291 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:4291 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
            GeneID:4291 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:4291 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.