Home |
Help |
Advanced search
2024-04-19 14:02:48, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001193427 2566 bp mRNA linear PRI 14-APR-2013
DEFINITION Homo sapiens suppressor of variegation 3-9 homolog 2 (Drosophila)
(SUV39H2), transcript variant 5, mRNA.
ACCESSION NM_001193427
VERSION NM_001193427.1 GI:301171612
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2566)
AUTHORS Syreeni,A., El-Osta,A., Forsblom,C., Sandholm,N., Parkkonen,M.,
Tarnow,L., Parving,H.H., McKnight,A.J., Maxwell,A.P., Cooper,M.E.
and Groop,P.H.
CONSRTM FinnDiane Study Group
TITLE Genetic examination of SETD7 and SUV39H1/H2 methyltransferases and
the risk of diabetes complications in patients with type 1 diabetes
JOURNAL Diabetes 60 (11), 3073-3080 (2011)
PUBMED 21896933
REMARK GeneRIF: genetic association studies in a Finnish population with
type I diabetes: The minor T allele of exonic SNP rs17353856 in
SUV39H2 is associated with diabetic retinopathy (in a larger
meta-analysis); thus an genetic variation may be protective.
REFERENCE 2 (bases 1 to 2566)
AUTHORS Benlhabib,H. and Mendelson,C.R.
TITLE Epigenetic regulation of surfactant protein A gene (SP-A)
expression in fetal lung reveals a critical role for Suv39h
methyltransferases during development and hypoxia
JOURNAL Mol. Cell. Biol. 31 (10), 1949-1958 (2011)
PUBMED 21402781
REMARK GeneRIF: findings suggest that Suv39H1 and Suv39H2 are key
hypoxia-induced methyltransferases; their decline in fetal lung
during late gestation is critical for epigenetic changes resulting
in the developmental induction of SP-A
REFERENCE 3 (bases 1 to 2566)
AUTHORS Sun,X.J., Xu,P.F., Zhou,T., Hu,M., Fu,C.T., Zhang,Y., Jin,Y.,
Chen,Y., Chen,S.J., Huang,Q.H., Liu,T.X. and Chen,Z.
TITLE Genome-wide survey and developmental expression mapping of
zebrafish SET domain-containing genes
JOURNAL PLoS ONE 3 (1), E1499 (2008)
PUBMED 18231586
REMARK GeneRIF: The SUV39H2 gene is found in tetrapods (e.g., human, mouse
and frog) but not in zebrafish, suggesting that this gene is
generated by a tetrapod lineage-specific gene duplication event.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 2566)
AUTHORS Wu,C., Ma,M.H., Brown,K.R., Geisler,M., Li,L., Tzeng,E., Jia,C.Y.,
Jurisica,I. and Li,S.S.
TITLE Systematic identification of SH3 domain-mediated human
protein-protein interactions by peptide array target screening
JOURNAL Proteomics 7 (11), 1775-1785 (2007)
PUBMED 17474147
REFERENCE 5 (bases 1 to 2566)
AUTHORS Yoon,K.A., Hwangbo,B., Kim,I.J., Park,S., Kim,H.S., Kee,H.J.,
Lee,J.E., Jang,Y.K., Park,J.G. and Lee,J.S.
TITLE Novel polymorphisms in the SUV39H2 histone methyltransferase and
the risk of lung cancer
JOURNAL Carcinogenesis 27 (11), 2217-2222 (2006)
PUBMED 16774942
REMARK GeneRIF: a novel SUV39H2 polymorphism may have a role in lung
cancer susceptibility for smokers
GeneRIF: Observational study of gene-disease association and
gene-environment interaction. (HuGE Navigator)
REFERENCE 6 (bases 1 to 2566)
AUTHORS Frontelo,P., Leader,J.E., Yoo,N., Potocki,A.C., Crawford,M.,
Kulik,M. and Lechleider,R.J.
TITLE Suv39h histone methyltransferases interact with Smads and cooperate
in BMP-induced repression
JOURNAL Oncogene 23 (30), 5242-5251 (2004)
PUBMED 15107829
REFERENCE 7 (bases 1 to 2566)
AUTHORS Deloukas,P., Earthrowl,M.E., Grafham,D.V., Rubenfield,M.,
French,L., Steward,C.A., Sims,S.K., Jones,M.C., Searle,S.,
Scott,C., Howe,K., Hunt,S.E., Andrews,T.D., Gilbert,J.G.,
Swarbreck,D., Ashurst,J.L., Taylor,A., Battles,J., Bird,C.P.,
Ainscough,R., Almeida,J.P., Ashwell,R.I., Ambrose,K.D.,
Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Bates,K.,
Beasley,H., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D.C.,
Burrill,W., Burton,J., Cahill,P., Camire,D., Carter,N.P.,
Chapman,J.C., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Corby,N.,
Coulson,A., Dhami,P., Dutta,I., Dunn,M., Faulkner,L., Frankish,A.,
Frankland,J.A., Garner,P., Garnett,J., Gribble,S., Griffiths,C.,
Grocock,R., Gustafson,E., Hammond,S., Harley,J.L., Hart,E.,
Heath,P.D., Ho,T.P., Hopkins,B., Horne,J., Howden,P.J., Huckle,E.,
Hynds,C., Johnson,C., Johnson,D., Kana,A., Kay,M., Kimberley,A.M.,
Kershaw,J.K., Kokkinaki,M., Laird,G.K., Lawlor,S., Lee,H.M.,
Leongamornlert,D.A., Laird,G., Lloyd,C., Lloyd,D.M., Loveland,J.,
Lovell,J., McLaren,S., McLay,K.E., McMurray,A.,
Mashreghi-Mohammadi,M., Matthews,L., Milne,S., Nickerson,T.,
Nguyen,M., Overton-Larty,E., Palmer,S.A., Pearce,A.V., Peck,A.I.,
Pelan,S., Phillimore,B., Porter,K., Rice,C.M., Rogosin,A.,
Ross,M.T., Sarafidou,T., Sehra,H.K., Shownkeen,R., Skuce,C.D.,
Smith,M., Standring,L., Sycamore,N., Tester,J., Thorpe,A.,
Torcasso,W., Tracey,A., Tromans,A., Tsolas,J., Wall,M., Walsh,J.,
Wang,H., Weinstock,K., West,A.P., Willey,D.L., Whitehead,S.L.,
Wilming,L., Wray,P.W., Young,L., Chen,Y., Lovering,R.C.,
Moschonas,N.K., Siebert,R., Fechtel,K., Bentley,D., Durbin,R.,
Hubbard,T., Doucette-Stamm,L., Beck,S., Smith,D.R. and Rogers,J.
TITLE The DNA sequence and comparative analysis of human chromosome 10
JOURNAL Nature 429 (6990), 375-381 (2004)
PUBMED 15164054
REFERENCE 8 (bases 1 to 2566)
AUTHORS Ait-Si-Ali,S., Guasconi,V., Fritsch,L., Yahi,H., Sekhri,R.,
Naguibneva,I., Robin,P., Cabon,F., Polesskaya,A. and
Harel-Bellan,A.
TITLE A Suv39h-dependent mechanism for silencing S-phase genes in
differentiating but not in cycling cells
JOURNAL EMBO J. 23 (3), 605-615 (2004)
PUBMED 14765126
REFERENCE 9 (bases 1 to 2566)
AUTHORS O'Carroll,D., Scherthan,H., Peters,A.H., Opravil,S., Haynes,A.R.,
Laible,G., Rea,S., Schmid,M., Lebersorger,A., Jerratsch,M.,
Sattler,L., Mattei,M.G., Denny,P., Brown,S.D., Schweizer,D. and
Jenuwein,T.
TITLE Isolation and characterization of Suv39h2, a second histone H3
methyltransferase gene that displays testis-specific expression
JOURNAL Mol. Cell. Biol. 20 (24), 9423-9433 (2000)
PUBMED 11094092
REFERENCE 10 (bases 1 to 2566)
AUTHORS Rea,S., Eisenhaber,F., O'Carroll,D., Strahl,B.D., Sun,Z.W.,
Schmid,M., Opravil,S., Mechtler,K., Ponting,C.P., Allis,C.D. and
Jenuwein,T.
TITLE Regulation of chromatin structure by site-specific histone H3
methyltransferases
JOURNAL Nature 406 (6796), 593-599 (2000)
PUBMED 10949293
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BU928392.1 and BC007754.2.
Transcript Variant: This variant (5) contains an alternate 5'
terminal exon, and uses an alternate donor splice site at an
internal coding exon compared to variant 1. This results in
translation initiation from an in-frame, downstream AUG, and a
shorter isoform (4) missing an internal protein segment compared
compared to isoform 1.
##Evidence-Data-START##
CDS exon combination :: BG501493.1 [ECO:0000331]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-489 BU928392.1 22-510
490-2566 BC007754.2 1017-3093
FEATURES Location/Qualifiers
source 1..2566
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="10"
/map="10p13"
gene 1..2566
/gene="SUV39H2"
/gene_synonym="KMT1B"
/note="suppressor of variegation 3-9 homolog 2
(Drosophila)"
/db_xref="GeneID:79723"
/db_xref="HGNC:17287"
/db_xref="MIM:606503"
exon 1..95
/gene="SUV39H2"
/gene_synonym="KMT1B"
/inference="alignment:Splign:1.39.8"
variation 19
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:375333545"
misc_feature 56..58
/gene="SUV39H2"
/gene_synonym="KMT1B"
/note="upstream in-frame stop codon"
variation 65
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="c"
/db_xref="dbSNP:374848659"
variation 75
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="g"
/db_xref="dbSNP:192886481"
variation 79
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:184647815"
exon 96..241
/gene="SUV39H2"
/gene_synonym="KMT1B"
/inference="alignment:Splign:1.39.8"
variation 172
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="g"
/replace="t"
/db_xref="dbSNP:369200305"
variation 183
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="c"
/db_xref="dbSNP:373386573"
exon 242..373
/gene="SUV39H2"
/gene_synonym="KMT1B"
/inference="alignment:Splign:1.39.8"
CDS 245..757
/gene="SUV39H2"
/gene_synonym="KMT1B"
/EC_number="2.1.1.43"
/note="isoform 4 is encoded by transcript variant 5;
histone-lysine N-methyltransferase SUV39H2; H3-K9-HMTase
2; su(var)3-9 homolog 2; lysine N-methyltransferase 1B;
histone H3-K9 methyltransferase 2"
/codon_start=1
/product="histone-lysine N-methyltransferase SUV39H2
isoform 4"
/protein_id="NP_001180356.1"
/db_xref="GI:301171613"
/db_xref="GeneID:79723"
/db_xref="HGNC:17287"
/db_xref="MIM:606503"
/translation="
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
"
misc_feature <248..343
/gene="SUV39H2"
/gene_synonym="KMT1B"
/note="Chromatin organization modifier (chromo) domain is
a conserved region of around 50 amino acids found in a
variety of chromosomal proteins, which appear to play a
role in the functional organization of the eukaryotic
nucleus. Experimental evidence...; Region: CHROMO;
cd00024"
/db_xref="CDD:28908"
misc_feature order(260..262,266..268,275..277,287..289,299..301,
311..316)
/gene="SUV39H2"
/gene_synonym="KMT1B"
/note="histone binding site; other site"
/db_xref="CDD:28908"
misc_feature <362..643
/gene="SUV39H2"
/gene_synonym="KMT1B"
/note="SET (Su(var)3-9, Enhancer-of-zeste, Trithorax)
domain; Region: SET; smart00317"
/db_xref="CDD:197649"
variation 331
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:148153307"
variation 352
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:376764262"
variation 354
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:140852434"
exon 374..520
/gene="SUV39H2"
/gene_synonym="KMT1B"
/inference="alignment:Splign:1.39.8"
variation 433
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:190174096"
variation 445
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:183140822"
variation 446
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:148667087"
variation 490
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:17353856"
variation 496
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:369186882"
variation 511
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:147278353"
exon 521..650
/gene="SUV39H2"
/gene_synonym="KMT1B"
/inference="alignment:Splign:1.39.8"
variation 565
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="g"
/db_xref="dbSNP:61730323"
variation 590
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:369793867"
exon 651..2560
/gene="SUV39H2"
/gene_synonym="KMT1B"
/inference="alignment:Splign:1.39.8"
variation 726
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:199727444"
variation 736
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="g"
/replace="t"
/db_xref="dbSNP:144605484"
variation 752
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:201395473"
variation 776
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="g"
/db_xref="dbSNP:375126181"
variation 812
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:368830300"
variation 848
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:113301024"
variation 869
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:373511332"
variation 884
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="c"
/db_xref="dbSNP:11547181"
variation 905
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:373567048"
variation 916
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="c"
/db_xref="dbSNP:180989547"
variation 920
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace=""
/replace="g"
/db_xref="dbSNP:375028927"
STS 1039..1160
/gene="SUV39H2"
/gene_synonym="KMT1B"
/standard_name="RH48597"
/db_xref="UniSTS:71892"
variation 1097
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="g"
/db_xref="dbSNP:116910335"
variation 1110
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="c"
/db_xref="dbSNP:75420442"
polyA_signal 1272..1277
/gene="SUV39H2"
/gene_synonym="KMT1B"
variation 1291..1293
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace=""
/replace="aat"
/db_xref="dbSNP:367684066"
polyA_site 1292
/gene="SUV39H2"
/gene_synonym="KMT1B"
polyA_site 1308
/gene="SUV39H2"
/gene_synonym="KMT1B"
polyA_signal 1317..1322
/gene="SUV39H2"
/gene_synonym="KMT1B"
variation 1329..1332
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace=""
/replace="aatt"
/db_xref="dbSNP:371874353"
polyA_site 1334
/gene="SUV39H2"
/gene_synonym="KMT1B"
polyA_site 1345
/gene="SUV39H2"
/gene_synonym="KMT1B"
variation 1442
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:142967205"
variation 1499
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="g"
/replace="t"
/db_xref="dbSNP:185218421"
variation 1561
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:41284455"
variation 1652
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:11594111"
variation 1723
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:190438184"
variation 1839
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:181251834"
variation 1977
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="g"
/replace="t"
/db_xref="dbSNP:61843036"
variation 2114
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:75516757"
variation 2136
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:376829730"
variation 2194
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:150828159"
variation 2319
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="g"
/replace="t"
/db_xref="dbSNP:139176971"
variation 2383
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:11259385"
STS 2422..2504
/gene="SUV39H2"
/gene_synonym="KMT1B"
/standard_name="L18426"
/db_xref="UniSTS:34648"
STS 2423..2502
/gene="SUV39H2"
/gene_synonym="KMT1B"
/standard_name="D5S1597E"
/db_xref="UniSTS:151019"
STS 2424..2526
/gene="SUV39H2"
/gene_synonym="KMT1B"
/standard_name="D11S2921"
/db_xref="UniSTS:152074"
STS 2426..2495
/gene="SUV39H2"
/gene_synonym="KMT1B"
/standard_name="D1S1423"
/db_xref="UniSTS:149619"
variation 2463
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="g"
/replace="t"
/db_xref="dbSNP:186353154"
variation 2481
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="t"
/db_xref="dbSNP:191603474"
variation 2482
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="g"
/db_xref="dbSNP:371491790"
variation 2501
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="c"
/replace="g"
/db_xref="dbSNP:183557434"
variation 2549
/gene="SUV39H2"
/gene_synonym="KMT1B"
/replace="a"
/replace="t"
/db_xref="dbSNP:79193913"
ORIGIN
agtttgaatgaaagctctacaagatggcggcggtcggggccgaggcgcgaggaggtgaggctggagcgcggccccctcgccttccctgttcccagcttggtgtgtgccttgcctagtttcacttgatactcttcaggaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcaccaaaaggaatctaaacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggatatggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacctttgcaaaatctgaagtgcccgttactgcttcagcaattctctaatgacaagcataattatttatctcaggtaatcacaagtgaagaagctgaaagacgaggacagttctatgacaacaagggaatcacgtatctctttgatctggactatgagtctgatgaattcacagtggatgcggctcgatacggcaatgtgtctcattttgtgaatcacagctgtgacccaaatcttcaggtgttcaatgttttcattgataacctcgatactcgtcttccccgaatagcattgttttccacaagaaccataaatgctggagaagagctgacttttgattatcaaatgaaaggttctggagatatatcttcagattctattgaccacagcccagccaaaaagagggtcagaacagtatgtaaatgtggagctgtgacttgcagaggttacctcaactgaactttttcaggaaatagagctgatgattataatatttttttcctaatgttaacatttttaaaaatacatatttgggactcttattatcaaggttctacctatgttaatttacaattcatgtttcaagacatttgccaaatgtattaccgatgcctctgaaaagggggtcactgggtctcatagactgatatgaagtcgacatatttatagtgcttagagaccaaactaatggaaggcagactatttacagcttagtatatgtgtacttaagtctatgtgaacagagaaatgcctcccgtagtgtttgaaagcgttaagctgataatgtaattaacaactgctgagagatcaaagattcaacttgccatacacctcaaattcggagaaacagttaatttgggcaaatctacagttctgtttttgctactctattgtcattcctgtttaatactcactgtacttgtatttgagacaaataggtgatactgaattttatactgttttctacttttccattaaaacattggcacctcaatgataaagaaatttaaggtataaaattaaatgtaaaaattaatttcagcttcatttcgtatttcgaagcaatctagactgttgtgatgagtgtatgtctgaacctgtaattcttaaaagacttcttaatcttctagaagaaaaatctccgaagagctctctctagaagtccaaaatggctagccattatgcttctttgaaaggacatgataatgggaccaggatggttttttggagtaccaagcaaggggaatggagcactttaagggcgcctgttagtaacatgaattggaaatctgtgtcgagtacctctgatctaaacggtaaaacaagctgcctggagagcagctgtacctaacaatactgtaatgtacattaacattacagcctctcaatttcaggcaggtgtaacagttcctttccaccagatttaatatttttatacttcctgcaggttcttcttaaaaagtaatctatatttttgaactgatacttgttttatacataaattttttttagatgtgataaagctaaacttggccaaagtgtgtgcctgaattattagacctttttattagtcaacctacgaagactaaaatagaatatattagttttcaagggagtgggaggcttccaacatagtattgaatctcaggaaaaactattctttcatgtctgattctgagatttctaattgtgttgtgaaaatgataaatgcagcaaatctagctttcagtattcctaatttttacctaagctcattgctccaggctttgattacctaaaataagcttggataaaattgaaccaacttcaagaatgcagcacttcttaatctttagctctttcttgggagaagctagactttattcattatattgctatgacaacttcactctttcataatatataggataaattgtttacatgattggaccctcagattctgttaaccaaaattgcagaatggggggccaggcctgtgtggtggctcacacctgtgatcccagcactttgggaggctgaggtaggaggatcacgtgaggtcgggagttcaagaccagcctggccatcatggtgaaaccctgtctctactgaaaatacaaaaattagccgggcgtggtggcacacgcctgtagtcccagctactcaggaggctgaggcaggagaatcacttgaattcaggaggcggaggttgcagtgagccaagatcataccactgcactgcagcctgagtgacacagtaagactgtctccaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:79723 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
GeneID:79723 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:79723 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
GeneID:79723 -> Molecular function: GO:0046974 [histone methyltransferase activity (H3-K9 specific)] evidence: IDA
GeneID:79723 -> Biological process: GO:0006333 [chromatin assembly or disassembly] evidence: IMP
GeneID:79723 -> Biological process: GO:0006338 [chromatin remodeling] evidence: IDA
GeneID:79723 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:79723 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
GeneID:79723 -> Biological process: GO:0007140 [male meiosis] evidence: IEA
GeneID:79723 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
GeneID:79723 -> Cellular component: GO:0000775 [chromosome, centromeric region] evidence: IEA
GeneID:79723 -> Cellular component: GO:0000785 [chromatin] evidence: IDA
GeneID:79723 -> Cellular component: GO:0005720 [nuclear heterochromatin] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001180356 -> EC 2.1.1.43
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.