2024-03-29 13:54:36, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001190943 1334 bp mRNA linear PRI 15-JUL-2013 DEFINITION Homo sapiens tumor necrosis factor (ligand) superfamily, member 10 (TNFSF10), transcript variant 3, mRNA. ACCESSION NM_001190943 VERSION NM_001190943.1 GI:300193033 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1334) AUTHORS Stagg,H.W., Bowen,K.A., Sawant,D.A., Rodriguez,M., Tharakan,B. and Childs,E.W. TITLE Tumor necrosis factor-related apoptosis-inducing ligand promotes microvascular endothelial cell hyperpermeability through phosphatidylinositol 3-kinase pathway JOURNAL Am. J. Surg. 205 (4), 419-425 (2013) PUBMED 23375756 REMARK GeneRIF: TRAIL-induced microvascular hyperpermeability is phosphatidylinositol 3-kinase (PI3K)-dependent and may be mediated by caspase-3 cleavage of the endothelial adherens junctional complex. REFERENCE 2 (bases 1 to 1334) AUTHORS Zhang,N., Wang,X., Huo,Q., Li,X., Wang,H., Schneider,P., Hu,G. and Yang,Q. TITLE The oncogene metadherin modulates the apoptotic pathway based on the tumor necrosis factor superfamily member TRAIL (Tumor Necrosis Factor-related Apoptosis-inducing Ligand) in breast cancer JOURNAL J. Biol. Chem. 288 (13), 9396-9407 (2013) PUBMED 23408429 REMARK GeneRIF: oncogene metadherin modulates the apoptotic pathway based on the tumor necrosis factor superfamily member TRAIL (Tumor Necrosis Factor-related Apoptosis-inducing Ligand) in breast cancer REFERENCE 3 (bases 1 to 1334) AUTHORS Levidou,G., Thymara,I., Saetta,A.A., Papanastasiou,P., Pavlopoulos,P., Sakellariou,S., Fragkou,P., Patsouris,E. and Korkolopoulou,P. TITLE TRAIL and osteoprotegerin (OPG) expression in bladder urothelial carcinoma: correlation with clinicopathological parameters and prognosis JOURNAL Pathology 45 (2), 138-144 (2013) PUBMED 23277172 REMARK GeneRIF: OPG and TRAIL are frequently expressed and coexpressed in bladder urothelial carcinomas, supporting the involvement of OPG in the resistance to TRAIL-driven apoptosis. REFERENCE 4 (bases 1 to 1334) AUTHORS Spes,A., Sobotic,B., Turk,V. and Turk,B. TITLE Cysteine cathepsins are not critical for TRAIL- and CD95-induced apoptosis in several human cancer cell lines JOURNAL Biol. Chem. 393 (12), 1417-1431 (2012) PUBMED 23667901 REMARK GeneRIF: Data indicate that cysteine cathepsins are not required for the TRAIL- and CD95-mediated apoptosis in various human cancer cell lines. REFERENCE 5 (bases 1 to 1334) AUTHORS Grunert,M., Gottschalk,K., Kapahnke,J., Gundisch,S., Kieser,A. and Jeremias,I. TITLE The adaptor protein FADD and the initiator caspase-8 mediate activation of NF-kappaB by TRAIL JOURNAL Cell Death Dis 3, E414 (2012) PUBMED 23096115 REMARK GeneRIF: FADD and the initiator caspase-8 mediate activation of NF-kappaB by TRAIL. Publication Status: Online-Only REFERENCE 6 (bases 1 to 1334) AUTHORS Pan,G., Ni,J., Wei,Y.F., Yu,G., Gentz,R. and Dixit,V.M. TITLE An antagonist decoy receptor and a death domain-containing receptor for TRAIL JOURNAL Science 277 (5327), 815-818 (1997) PUBMED 9242610 REFERENCE 7 (bases 1 to 1334) AUTHORS Pan,G., O'Rourke,K., Chinnaiyan,A.M., Gentz,R., Ebner,R., Ni,J. and Dixit,V.M. TITLE The receptor for the cytotoxic ligand TRAIL JOURNAL Science 276 (5309), 111-113 (1997) PUBMED 9082980 REFERENCE 8 (bases 1 to 1334) AUTHORS Marsters,S.A., Pitti,R.M., Donahue,C.J., Ruppert,S., Bauer,K.D. and Ashkenazi,A. TITLE Activation of apoptosis by Apo-2 ligand is independent of FADD but blocked by CrmA JOURNAL Curr. Biol. 6 (6), 750-752 (1996) PUBMED 8793301 REFERENCE 9 (bases 1 to 1334) AUTHORS Pitti,R.M., Marsters,S.A., Ruppert,S., Donahue,C.J., Moore,A. and Ashkenazi,A. TITLE Induction of apoptosis by Apo-2 ligand, a new member of the tumor necrosis factor cytokine family JOURNAL J. Biol. Chem. 271 (22), 12687-12690 (1996) PUBMED 8663110 REFERENCE 10 (bases 1 to 1334) AUTHORS Wiley,S.R., Schooley,K., Smolak,P.J., Din,W.S., Huang,C.P., Nicholl,J.K., Sutherland,G.R., Smith,T.D., Rauch,C., Smith,C.A. et al. TITLE Identification and characterization of a new member of the TNF family that induces apoptosis JOURNAL Immunity 3 (6), 673-682 (1995) PUBMED 8777713 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC007919.18 and AC016938.24. Summary: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]. Transcript Variant: This variant (3) lacks multiple 3' exons, but has an alternate 3' exon, as compared to variant 1. The resulting isoform (3) is very short and has a different C-terminus, as compared to isoform 1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK309200.1, DA398853.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025083, ERS025089 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-223 AC007919.18 4049-4271 c 224-1334 AC016938.24 37606-38716 c FEATURES Location/Qualifiers source 1..1334 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="3" /map="3q26" gene 1..1334 /gene="TNFSF10" /gene_synonym="Apo-2L; APO2L; CD253; TL2; TRAIL" /note="tumor necrosis factor (ligand) superfamily, member 10" /db_xref="GeneID:8743" /db_xref="HGNC:11925" /db_xref="MIM:603598" exon 1..223 /gene="TNFSF10" /gene_synonym="Apo-2L; APO2L; CD253; TL2; TRAIL" /inference="alignment:Splign:1.39.8" misc_feature 17..19 /gene="TNFSF10" /gene_synonym="Apo-2L; APO2L; CD253; TL2; TRAIL" /note="upstream in-frame stop codon" CDS 92..289 /gene="TNFSF10" /gene_synonym="Apo-2L; APO2L; CD253; TL2; TRAIL" /note="isoform 3 is encoded by transcript variant 3; Apo-2 ligand; TNF-related apoptosis inducing ligand TRAIL; tumor necrosis factor (ligand) family, member 10; tumor necrosis factor apoptosis-inducing ligand splice variant delta; chemokine tumor necrosis factor ligand superfamily member 10" /codon_start=1 /product="tumor necrosis factor ligand superfamily member 10 isoform 3" /protein_id="NP_001177872.1" /db_xref="GI:300193034" /db_xref="GeneID:8743" /db_xref="HGNC:11925" /db_xref="MIM:603598" /translation="
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQFAENDCQRLMSGQQTGSLLPS
" variation 140 /gene="TNFSF10" /gene_synonym="Apo-2L; APO2L; CD253; TL2; TRAIL" /replace="a" /replace="g" /db_xref="dbSNP:11545817" exon 224..1334 /gene="TNFSF10" /gene_synonym="Apo-2L; APO2L; CD253; TL2; TRAIL" /inference="alignment:Splign:1.39.8" variation 1127 /gene="TNFSF10" /gene_synonym="Apo-2L; APO2L; CD253; TL2; TRAIL" /replace="g" /replace="t" /db_xref="dbSNP:200047251" ORIGIN
atttcctcactgactataaaagaatagagaaggaagggcttcagtgaccggctgcctggctgacttacagcagtcagactctgacaggatcatggctatgatggaggtccaggggggacccagcctgggacagacctgcgtgctgatcgtgatcttcacagtgctcctgcagtctctctgtgtggctgtaacttacgtgtactttaccaacgagctgaagcagtttgcagaaaatgattgccagagactaatgtctgggcagcagacagggtcattgctgccatcttgaagtctaccttgctgagtctaccctgctgacctcaagccccatcaaggactggttgaccctggcctagacaaccaccgtgtttgtaacagcaccaagagcagtcaccatggaaatccacttttcagaaccaagggcttctggagctgaagaacaggcacccagtgcaagagctttcttttcagaggcacgcaaatgaaaataatccccacacgctaccttctgcccccaatgcccaagtgtggttagttagagaatatagcctcagcctatgatatgctgcaggaaactcatattttgaagtggaaaggatgggaggaggcgggggagacgtatcgtattaattatcattcttggaataaccacagcacctcacgtcaacccgccatgtgtctagtcaccagcattggccaagttctataggagaaactaccaaaattcatgatgcaagaaacatgtgagggtggagagagtgactggggcttcctctctggatttctattgttcagaaatcaatatttatgcataaaaaggtctagaaagagaaacaccaaaatgacaatgtgatctctagatggtatgattatgggtactttttttcctttttatttttctatattttacaaattttctacagggaatgttataaaaatatccatgctatccatgtataattttcatacagatttaaagaacacagcatttttatatagtcttatgagaaaacaaccatactcaaaattatgcacacacacagtctgatctcacccctgtaaacaagagatatcatccaaaggttaagtaggaggtgagaatatagctgctattagtggttgttttgttttgtttttgtgatttacttatttagtttttggagggttttttttttcttttagaaaagtgttctttacttttccatgcttccctgcttgcctgtgtatcctgaatgtatccaggctttataaactcctgggtaataatgtagctacattaacttgttaacctcccatccacttatacccaggaccttactcaattttccaggttc
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8743 -> Molecular function: GO:0005102 [receptor binding] evidence: TAS GeneID:8743 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA GeneID:8743 -> Molecular function: GO:0005164 [tumor necrosis factor receptor binding] evidence: IEA GeneID:8743 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:8743 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA GeneID:8743 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:8743 -> Biological process: GO:0006917 [induction of apoptosis] evidence: TAS GeneID:8743 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: TAS GeneID:8743 -> Biological process: GO:0006955 [immune response] evidence: IEA GeneID:8743 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:8743 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS GeneID:8743 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IDA GeneID:8743 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IEP GeneID:8743 -> Biological process: GO:0043280 [positive regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA GeneID:8743 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IDA GeneID:8743 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS GeneID:8743 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IDA GeneID:8743 -> Biological process: GO:2001239 [regulation of extrinsic apoptotic signaling pathway in absence of ligand] evidence: TAS GeneID:8743 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS GeneID:8743 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA GeneID:8743 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.