Home |
Help |
Advanced search
2024-04-26 13:07:34, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001190441 600 bp mRNA linear PRI 18-APR-2013
DEFINITION Homo sapiens lectin, galactoside-binding, soluble, 16 (LGALS16),
mRNA.
ACCESSION NM_001190441 XM_001721300 XM_001721341 XM_001723341 XM_001723342
XM_086001 XM_942526
VERSION NM_001190441.1 GI:298919184
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 600)
AUTHORS Than,N.G., Romero,R., Goodman,M., Weckle,A., Xing,J., Dong,Z.,
Xu,Y., Tarquini,F., Szilagyi,A., Gal,P., Hou,Z., Tarca,A.L.,
Kim,C.J., Kim,J.S., Haidarian,S., Uddin,M., Bohn,H., Benirschke,K.,
Santolaya-Forgas,J., Grossman,L.I., Erez,O., Hassan,S.S.,
Zavodszky,P., Papp,Z. and Wildman,D.E.
TITLE A primate subfamily of galectins expressed at the maternal-fetal
interface that promote immune cell death
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 106 (24), 9731-9736 (2009)
PUBMED 19497882
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC093051.2 and AC005515.1.
On or before Jun 23, 2010 this sequence version replaced
gi:169213286, gi:169213287, gi:169214329, gi:169214330,
gi:169213905, gi:169213907.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
##Evidence-Data-START##
Transcript exon combination :: CD386476.1, FJ613352.1 [ECO:0000332]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-59 AC093051.2 3945-4003
60-136 AC005515.1 3925-4001
137-347 AC005515.1 4502-4712
348-600 AC005515.1 6437-6689
FEATURES Location/Qualifiers
source 1..600
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.2"
gene 1..600
/gene="LGALS16"
/note="lectin, galactoside-binding, soluble, 16"
/db_xref="GeneID:148003"
/db_xref="HGNC:40039"
exon 1..59
/gene="LGALS16"
/inference="alignment:Splign:1.39.8"
CDS 45..473
/gene="LGALS16"
/note="beta-galactoside-binding lectin"
/codon_start=1
/product="galectin-16"
/protein_id="NP_001177370.1"
/db_xref="GI:298919185"
/db_xref="CCDS:CCDS54267.1"
/db_xref="GeneID:148003"
/db_xref="HGNC:40039"
/translation="
MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR
"
misc_feature 60..449
/gene="LGALS16"
/note="Galectin/galactose-binding lectin. This domain
exclusively binds beta-galactosides, such as lactose, and
does not require metal ions for activity. GLECT domains
occur as homodimers or tandemly repeated domains. They are
developmentally regulated and may...; Region: GLECT;
cd00070"
/db_xref="CDD:28952"
misc_feature order(60..74,435..449)
/gene="LGALS16"
/note="dimerization interface [polypeptide binding]; other
site"
/db_xref="CDD:28952"
misc_feature 60..74
/gene="LGALS16"
/note="dimerization swap strand; other site"
/db_xref="CDD:28952"
misc_feature order(87..95,102..104,111..113,324..332,345..347,351..353,
360..362)
/gene="LGALS16"
/note="putative alternate dimerization interface
[polypeptide binding]; other site"
/db_xref="CDD:28952"
misc_feature order(201..203,207..209,213..215,231..233,237..239,
258..260,267..269,273..275)
/gene="LGALS16"
/note="sugar binding pocket [chemical binding]; other
site"
/db_xref="CDD:28952"
exon 60..136
/gene="LGALS16"
/inference="alignment:Splign:1.39.8"
variation 121
/gene="LGALS16"
/replace="c"
/replace="t"
/db_xref="dbSNP:10403702"
variation 135
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:113930745"
exon 137..347
/gene="LGALS16"
/inference="alignment:Splign:1.39.8"
variation 139
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:201930366"
variation 179
/gene="LGALS16"
/replace="c"
/replace="t"
/db_xref="dbSNP:138874309"
variation 208
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:116331309"
variation 219
/gene="LGALS16"
/replace=""
/replace="g"
/db_xref="dbSNP:35476378"
variation 223
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:149409914"
variation 226
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:184657849"
variation 262
/gene="LGALS16"
/replace="c"
/replace="t"
/db_xref="dbSNP:147471254"
variation 300
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:187604453"
variation 334
/gene="LGALS16"
/replace="a"
/replace="t"
/db_xref="dbSNP:1860134"
exon 348..600
/gene="LGALS16"
/inference="alignment:Splign:1.39.8"
variation 360
/gene="LGALS16"
/replace="g"
/replace="t"
/db_xref="dbSNP:190910422"
variation 411
/gene="LGALS16"
/replace="a"
/replace="c"
/db_xref="dbSNP:181925874"
variation 437
/gene="LGALS16"
/replace="c"
/replace="t"
/db_xref="dbSNP:148828240"
variation 458
/gene="LGALS16"
/replace="a"
/replace="c"
/db_xref="dbSNP:186797209"
variation 466
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:367627881"
variation 484
/gene="LGALS16"
/replace="c"
/replace="t"
/db_xref="dbSNP:191782299"
variation 527
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:112620313"
variation 584
/gene="LGALS16"
/replace="a"
/replace="g"
/db_xref="dbSNP:183190594"
ORIGIN
gaagactggacacaattccgaaggtcgcccagaaggagaggacaatgtcatttctaactgtgccatacaaactgcctgtgtctttgtctgttggttcctgcgtgataatcaaagggacactgatcgactcttctatcaacgaaccacagctgcaggtggatttctacactgagatgaatgaggactcagaaattgccttccatttgcgagtgcacttaggccgtcgtgtggtcatgaacagtcgtgagtttgggatatggatgttggaggagaatttacactatgtgccctttgaggatggcaaaccatttgacttgcgcatctacgtgtgtctcaatgagtatgaggtaaaggtaaatggtgaatacatttatgcctttgtccatcgaatcccgccatcatatgtgaagatgattcaagtgtggagagatgtctccctggactcagtgcttgtcaacaatggacggagatgatcacactcctcattgttgaggaaaccctctttctacctgaccatgggattcctagagcctgctaacagaataatccctcctcaaccccttcccctacacttggtcattaaaacagcaccaaaccgta
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:148003 -> Molecular function: GO:0030395 [lactose binding] evidence: IDA
GeneID:148003 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:148003 -> Biological process: GO:0070234 [positive regulation of T cell apoptotic process] evidence: IDA
GeneID:148003 -> Cellular component: GO:0005575 [cellular_component] evidence: ND
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.