GGRNA Home | Help | Advanced search

2025-07-15 04:54:13, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001190263            1281 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens C1D nuclear receptor corepressor (C1D), transcript
            variant 3, mRNA.
ACCESSION   NM_001190263
VERSION     NM_001190263.1  GI:298231252
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1281)
  AUTHORS   Han,S., Lan,Q., Park,A.K., Lee,K.M., Park,S.K., Ahn,H.S.,
            Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E., Ahn,Y.O.,
            Chanock,S.J., Kim,H., Rothman,N. and Kang,D.
  TITLE     Polymorphisms in innate immunity genes and risk of childhood
            leukemia
  JOURNAL   Hum. Immunol. 71 (7), 727-730 (2010)
   PUBMED   20438785
  REMARK    GeneRIF: Observational study of gene-disease association and
            gene-gene interaction. (HuGE Navigator)
REFERENCE   2  (bases 1 to 1281)
  AUTHORS   Li,G., Liu,J., Abu-Asab,M., Masabumi,S. and Maru,Y.
  TITLE     XPB induces C1D expression to counteract UV-induced apoptosis
  JOURNAL   Mol. Cancer Res. 8 (6), 885-895 (2010)
   PUBMED   20530579
  REMARK    GeneRIF: C1D is associated with the DNA repair complex and may
            promote repair of ultraviolet irradiation-induced DNA damage.
REFERENCE   3  (bases 1 to 1281)
  AUTHORS   Rajaraman,P., Brenner,A.V., Neta,G., Pfeiffer,R., Wang,S.S.,
            Yeager,M., Thomas,G., Fine,H.A., Linet,M.S., Rothman,N.,
            Chanock,S.J. and Inskip,P.D.
  TITLE     Risk of meningioma and common variation in genes related to innate
            immunity
  JOURNAL   Cancer Epidemiol. Biomarkers Prev. 19 (5), 1356-1361 (2010)
   PUBMED   20406964
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 1281)
  AUTHORS   Rajaraman,P., Brenner,A.V., Butler,M.A., Wang,S.S., Pfeiffer,R.M.,
            Ruder,A.M., Linet,M.S., Yeager,M., Wang,Z., Orr,N., Fine,H.A.,
            Kwon,D., Thomas,G., Rothman,N., Inskip,P.D. and Chanock,S.J.
  TITLE     Common variation in genes related to innate immunity and risk of
            adult glioma
  JOURNAL   Cancer Epidemiol. Biomarkers Prev. 18 (5), 1651-1658 (2009)
   PUBMED   19423540
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 1281)
  AUTHORS   Schilders,G., Egberts,W.V., Raijmakers,R. and Pruijn,G.J.
  TITLE     C1D is a major autoantibody target in patients with the
            polymyositis-scleroderma overlap syndrome
  JOURNAL   Arthritis Rheum. 56 (7), 2449-2454 (2007)
   PUBMED   17599775
  REMARK    GeneRIF: Anti-C1D autoantibodies were observed in patients with
            polymyositis-scleroderma overlap syndrome.
REFERENCE   6  (bases 1 to 1281)
  AUTHORS   Rothbarth,K., Spiess,E., Juodka,B., Yavuzer,U., Nehls,P.,
            Stammer,H. and Werner,D.
  TITLE     Induction of apoptosis by overexpression of the DNA-binding and
            DNA-PK-activating protein C1D
  JOURNAL   J. Cell. Sci. 112 (PT 13), 2223-2232 (1999)
   PUBMED   10362552
REFERENCE   7  (bases 1 to 1281)
  AUTHORS   Yavuzer,U., Smith,G.C., Bliss,T., Werner,D. and Jackson,S.P.
  TITLE     DNA end-independent activation of DNA-PK mediated via association
            with the DNA-binding protein C1D
  JOURNAL   Genes Dev. 12 (14), 2188-2199 (1998)
   PUBMED   9679063
  REMARK    GeneRIF: The C1D protein interacts with the catalytic subunit of
            DNA-PK and is a very effective substrate for DNA-PK in vitro.
            Moreover, C1D directs the activation of DNA-PK in a manner that
            does not require DNA termini, suggesting a role for C1D in DNA
            repair.
REFERENCE   8  (bases 1 to 1281)
  AUTHORS   Haataja,L., Groffen,J. and Heisterkamp,N.
  TITLE     Identification of a novel Rac3-interacting protein C1D
  JOURNAL   Int. J. Mol. Med. 1 (4), 665-670 (1998)
   PUBMED   9852280
REFERENCE   9  (bases 1 to 1281)
  AUTHORS   Nehls,P., Keck,T., Greferath,R., Spiess,E., Glaser,T.,
            Rothbarth,K., Stammer,H. and Werner,D.
  TITLE     cDNA cloning, recombinant expression and characterization of
            polypetides with exceptional DNA affinity
  JOURNAL   Nucleic Acids Res. 26 (5), 1160-1166 (1998)
   PUBMED   9469821
REFERENCE   10 (bases 1 to 1281)
  AUTHORS   Zamir,I., Dawson,J., Lavinsky,R.M., Glass,C.K., Rosenfeld,M.G. and
            Lazar,M.A.
  TITLE     Cloning and characterization of a corepressor and potential
            component of the nuclear hormone receptor repression complex
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 94 (26), 14400-14405 (1997)
   PUBMED   9405624
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BG505686.1, AK290451.1,
            AC079112.4 and AI004680.1.
            
            Summary: The protein encoded by this gene is a DNA binding and
            apoptosis-inducing protein and is localized in the nucleus. It is
            also a Rac3-interacting protein which acts as a corepressor for the
            thyroid hormone receptor. This protein is thought to regulate
            TRAX/Translin complex formation. Alternate splicing results in
            multiple transcript variants that encode the same protein. Multiple
            pseudogenes of this gene are found on chromosome 10.[provided by
            RefSeq, Jun 2010].
            
            Transcript Variant: This variant (3) differs in the 5' UTR compared
            to variant 1. Variants 1, 2, 3 and 4 encode the same protein.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK290451.1, DA486654.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025082 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-17                BG505686.1         1-17
            18-381              AK290451.1         1-364
            382-382             AC079112.4         119422-119422       c
            383-599             AK290451.1         366-582
            600-702             AC079112.4         116168-116270       c
            703-1281            AI004680.1         1-579               c
FEATURES             Location/Qualifiers
     source          1..1281
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p13-p12"
     gene            1..1281
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /note="C1D nuclear receptor corepressor"
                     /db_xref="GeneID:10438"
                     /db_xref="HGNC:29911"
                     /db_xref="MIM:606997"
     exon            1..70
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    67..69
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /note="upstream in-frame stop codon"
     exon            71..147
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="alignment:Splign:1.39.8"
     exon            148..294
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="alignment:Splign:1.39.8"
     CDS             157..582
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /note="C1D nuclear receptor co-repressor; small unique
                     nuclear receptor co-repressor; nuclear DNA-binding
                     protein; small unique nuclear receptor corepressor; C1D
                     DNA-binding protein"
                     /codon_start=1
                     /product="nuclear nucleic acid-binding protein C1D"
                     /protein_id="NP_001177192.1"
                     /db_xref="GI:298231253"
                     /db_xref="CCDS:CCDS1883.1"
                     /db_xref="GeneID:10438"
                     /db_xref="HGNC:29911"
                     /db_xref="MIM:606997"
                     /translation="
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
"
     misc_feature    157..456
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q13901.1);
                     Region: Required for transcriptional repression (By
                     similarity)"
     misc_feature    205..444
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /note="Sas10/Utp3/C1D family; Region: Sas10_Utp3;
                     pfam04000"
                     /db_xref="CDD:202850"
     misc_feature    304..456
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q13901.1);
                     Region: Interaction with NR1D1 (By similarity)"
     misc_feature    454..579
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q13901.1);
                     Region: Interaction with NCOR1 and NCOR2 (By similarity)"
     STS             157..303
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /standard_name="PMC24996P1"
                     /db_xref="UniSTS:272278"
     exon            295..361
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="alignment:Splign:1.39.8"
     exon            362..417
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="alignment:Splign:1.39.8"
     exon            418..1271
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /inference="alignment:Splign:1.39.8"
     variation       535
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10444"
     STS             929..1136
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /standard_name="RH40315"
                     /db_xref="UniSTS:85797"
     STS             1115..1264
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /standard_name="G23952"
                     /db_xref="UniSTS:2406"
     STS             1135..1259
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
                     /standard_name="RH69539"
                     /db_xref="UniSTS:86905"
     polyA_signal    1243..1248
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
     polyA_site      1271
                     /gene="C1D"
                     /gene_synonym="hC1D; LRP1; SUN-CoR; SUNCOR"
ORIGIN      
agagccggcgcgtcattgtcgtcatcgttgcccgaccgctttccgggagactggagtcgaaggccgtgagccagtgttttagaaggagtatgtggaagggcaaggagtacctatagaaccccggaggagggtgaggagcagagctggtcagccataatggcaggtgaagaaattaatgaagactatccagtagaaattcacgagtatttgtcagcgtttgagaattccattggtgctgtggatgagatgctgaagaccatgatgtctgtttctagaaatgagttgttgcagaagttggatccacttgaacaagcaaaagtggatttggtttctgcatacacattaaattcaatgttttgggtttatttggcaacccaaggagttaatcctaaggaacatccagtaaaacaggaattggaaagaatcagagtatatatgaacagagtcaaggaaataacagacaagaaaaaggctggcaagctggacagaggtgcagcttcaagatttgtaaaaaatgccctctgggaaccaaaatcgaaaaatgcatcaaaagttgccaataaaggaaaaagtaaaagttaactttttggttttgatgtacacatattcaaaaagtacatcttcccccccccccccccccccgcaaaataattctgtggcagggcaaggtttaaatgtgtttcttattaatatgtaaattcacagtaaatatgtaaagctaaatactttcctctccaaagatcattatctttattgattagcactgaggattttaacattgtgatatattatatatttataatttaccatctcttgatgagactcttatttctttatataggtcagtcttgcaagtaccattttataagcagctgtgaaatttaagtgaaatgttctttgtaaacatttgtactattttaaatgaataatgaccttatgaagtatgctatctgtaggctgaaattataggtacatctgttttcactatatgatattaagaaagcgtgaaatgacttaaatgttcatttttttctgtatagatactttatcatgttttcatgattttaggaattactgctttgttgatattcaaagtgtgaaactaaaactttatggttgtactttaattcttggcatgttgcctctatgtcccatttaaaataaaatacattctcattaactttagatgggaaataaggttgtatgttgatggatgaattttggcatgatgactgtactctcaataaaggctgaaaatgttgtataactgaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:10438 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
            GeneID:10438 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: IEA
            GeneID:10438 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA
            GeneID:10438 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:10438 -> Molecular function: GO:0016922 [ligand-dependent nuclear receptor binding] evidence: IEA
            GeneID:10438 -> Biological process: GO:0000460 [maturation of 5.8S rRNA] evidence: IMP
            GeneID:10438 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:10438 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:10438 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IEA
            GeneID:10438 -> Cellular component: GO:0000176 [nuclear exosome (RNase complex)] evidence: TAS
            GeneID:10438 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:10438 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
            GeneID:10438 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
            GeneID:10438 -> Cellular component: GO:0017053 [transcriptional repressor complex] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.