Home |
Help |
Advanced search
2024-04-27 02:54:46, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001188 2203 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens BCL2-antagonist/killer 1 (BAK1), mRNA.
ACCESSION NM_001188
VERSION NM_001188.3 GI:109698605
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2203)
AUTHORS Beverly,L.J., Howell,L.A., Hernandez-Corbacho,M., Casson,L.,
Chipuk,J.E. and Siskind,L.J.
TITLE BAK activation is necessary and sufficient to drive ceramide
synthase-dependent ceramide accumulation following inhibition of
BCL2-like proteins
JOURNAL Biochem. J. 452 (1), 111-119 (2013)
PUBMED 23480852
REMARK GeneRIF: BAK activation increases ceramide synthase levels and
ceramide accumulation in tumor cell lines.
REFERENCE 2 (bases 1 to 2203)
AUTHORS Moldoveanu,T., Grace,C.R., Llambi,F., Nourse,A., Fitzgerald,P.,
Gehring,K., Kriwacki,R.W. and Green,D.R.
TITLE BID-induced structural changes in BAK promote apoptosis
JOURNAL Nat. Struct. Mol. Biol. 20 (5), 589-597 (2013)
PUBMED 23604079
REMARK GeneRIF: BAK activation follows a 'hit-and-run' mechanism whereby
BID dissociates from the trigger site, which allows BAK
oligomerization at an overlapping interface.
REFERENCE 3 (bases 1 to 2203)
AUTHORS Leshchiner,E.S., Braun,C.R., Bird,G.H. and Walensky,L.D.
TITLE Direct activation of full-length proapoptotic BAK
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (11), E986-E995 (2013)
PUBMED 23404709
REMARK GeneRIF: activation of both BAK and BAX is initiated by direct
BH3-interaction but at distinct trigger sites.
REFERENCE 4 (bases 1 to 2203)
AUTHORS Tran,V.H., Bartolo,R., Westphal,D., Alsop,A., Dewson,G. and
Kluck,R.M.
TITLE Bak apoptotic function is not directly regulated by phosphorylation
JOURNAL Cell Death Dis 4, E452 (2013)
PUBMED 23303126
REMARK GeneRIF: Bak is not significantly phosphorylated at any residue,
and Bak activation during apoptosis does not require
dephosphorylation.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 2203)
AUTHORS Kim,M.S., Kim,S.S., Yoo,N.J. and Lee,S.H.
TITLE Rare somatic mutation of pro-apoptotic BAX and BAK genes in common
human cancers
JOURNAL Tumori 98 (6), 149E-151E (2012)
PUBMED 23389372
REMARK GeneRIF: data indicate that somatic mutation of BAX and BAK genes
are rare in the common cancers (besides the cancers with high
microsatellite instability) and suggest that neither BAX nor BAK
mutation may causally be implicated in their tumorigenesis
REFERENCE 6 (bases 1 to 2203)
AUTHORS Sattler,M., Liang,H., Nettesheim,D., Meadows,R.P., Harlan,J.E.,
Eberstadt,M., Yoon,H.S., Shuker,S.B., Chang,B.S., Minn,A.J.,
Thompson,C.B. and Fesik,S.W.
TITLE Structure of Bcl-xL-Bak peptide complex: recognition between
regulators of apoptosis
JOURNAL Science 275 (5302), 983-986 (1997)
PUBMED 9020082
REFERENCE 7 (bases 1 to 2203)
AUTHORS Chittenden,T., Flemington,C., Houghton,A.B., Ebb,R.G., Gallo,G.J.,
Elangovan,B., Chinnadurai,G. and Lutz,R.J.
TITLE A conserved domain in Bak, distinct from BH1 and BH2, mediates cell
death and protein binding functions
JOURNAL EMBO J. 14 (22), 5589-5596 (1995)
PUBMED 8521816
REFERENCE 8 (bases 1 to 2203)
AUTHORS Kiefer,M.C., Brauer,M.J., Powers,V.C., Wu,J.J., Umansky,S.R.,
Tomei,L.D. and Barr,P.J.
TITLE Modulation of apoptosis by the widely distributed Bcl-2 homologue
Bak
JOURNAL Nature 374 (6524), 736-739 (1995)
PUBMED 7715731
REFERENCE 9 (bases 1 to 2203)
AUTHORS Chittenden,T., Harrington,E.A., O'Connor,R., Flemington,C.,
Lutz,R.J., Evan,G.I. and Guild,B.C.
TITLE Induction of apoptosis by the Bcl-2 homologue Bak
JOURNAL Nature 374 (6524), 733-736 (1995)
PUBMED 7715730
REFERENCE 10 (bases 1 to 2203)
AUTHORS Farrow,S.N., White,J.H., Martinou,I., Raven,T., Pun,K.T.,
Grinham,C.J., Martinou,J.C. and Brown,R.
TITLE Cloning of a bcl-2 homologue by interaction with adenovirus E1B 19K
JOURNAL Nature 374 (6524), 731-733 (1995)
PUBMED 7715729
REMARK Erratum:[Nature 1995 Jun 1;375(6530):431]
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CB142221.1, BC004431.1,
Z93017.6 and BM855203.1.
On Jun 28, 2006 this sequence version replaced gi:33457353.
Summary: The protein encoded by this gene belongs to the BCL2
protein family. BCL2 family members form oligomers or heterodimers
and act as anti- or pro-apoptotic regulators that are involved in a
wide variety of cellular activities. This protein localizes to
mitochondria, and functions to induce apoptosis. It interacts with
and accelerates the opening of the mitochondrial voltage-dependent
anion channel, which leads to a loss in membrane potential and the
release of cytochrome c. This protein also interacts with the tumor
suppressor P53 after exposure to cell stress. [provided by RefSeq,
Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC004431.1, U16811.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-89 CB142221.1 1-89
90-1008 BC004431.1 1-919
1009-1965 Z93017.6 80204-81160 c
1966-2203 BM855203.1 1-238
FEATURES Location/Qualifiers
source 1..2203
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p21.3"
gene 1..2203
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="BCL2-antagonist/killer 1"
/db_xref="GeneID:578"
/db_xref="HGNC:949"
/db_xref="HPRD:02744"
/db_xref="MIM:600516"
exon 1..269
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/inference="alignment:Splign:1.39.8"
exon 270..370
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/inference="alignment:Splign:1.39.8"
misc_feature 295..297
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="upstream in-frame stop codon"
CDS 301..936
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="pro-apoptotic protein BAK; apoptosis regulator BAK;
BCL2-like 7 protein; bcl2-L-7; bcl-2-like protein 7"
/codon_start=1
/product="bcl-2 homologous antagonist/killer"
/protein_id="NP_001179.1"
/db_xref="GI:4502363"
/db_xref="CCDS:CCDS4781.1"
/db_xref="GeneID:578"
/db_xref="HGNC:949"
/db_xref="HPRD:02744"
/db_xref="MIM:600516"
/translation="
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
"
misc_feature 385..837
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="Apoptosis regulator proteins of the Bcl-2 family,
named after B-cell lymphoma 2. This alignment model spans
what have been described as Bcl-2 homology regions BH1,
BH2, BH3, and BH4. Many members of this family have an
additional C-terminal transmembrane...; Region:
Bcl-2_like; cd06845"
/db_xref="CDD:132900"
misc_feature 385..426
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="BH4; other site"
/db_xref="CDD:132900"
misc_feature 520..564
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q16611.1);
Region: BH3"
misc_feature 532..558
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="BH3; other site"
/db_xref="CDD:132900"
misc_feature order(541..546,550..555,565..567,574..579,625..630,
637..642,649..654,670..672,676..681,685..690,700..702,
712..714)
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="BH3-homology region binding site; other site"
/db_xref="CDD:132900"
misc_feature 649..708
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q16611.1);
Region: BH1"
misc_feature order(649..657,667..705)
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="BH1; other site"
/db_xref="CDD:132900"
misc_feature 805..852
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q16611.1);
Region: BH2"
misc_feature 805..837
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/note="BH2; other site"
/db_xref="CDD:132900"
misc_feature 862..915
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q16611.1);
transmembrane region"
variation 342
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="c"
/replace="t"
/db_xref="dbSNP:2227925"
exon 371..506
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/inference="alignment:Splign:1.39.8"
variation 383
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="c"
/replace="t"
/db_xref="dbSNP:4987115"
variation 425
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1051911"
variation 455
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1051912"
exon 507..650
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/inference="alignment:Splign:1.39.8"
variation 507
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="a"
/replace="c"
/db_xref="dbSNP:5745592"
variation 543
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1051913"
exon 651..831
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/inference="alignment:Splign:1.39.8"
exon 832..2193
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/inference="alignment:Splign:1.39.8"
variation 1108
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="c"
/replace="g"
/db_xref="dbSNP:5745596"
variation 1178
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="a"
/replace="g"
/db_xref="dbSNP:5745597"
STS 1224..1568
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/standard_name="D11S4366"
/db_xref="UniSTS:38127"
STS 1916..2059
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/standard_name="RH64934"
/db_xref="UniSTS:89222"
variation 2086
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1051940"
variation 2092
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1051945"
variation 2124
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1051958"
variation 2141
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
/replace="a"
/replace="c"
/db_xref="dbSNP:1051964"
polyA_signal 2166..2171
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
polyA_site 2183
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
polyA_site 2187
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
polyA_site 2193
/gene="BAK1"
/gene_synonym="BAK; BAK-LIKE; BCL2L7; CDN1"
ORIGIN
gtctgcatccggtggccacagagcaacttcctctagagggagctgattggagccgggtgccgctggcacctctatgatcactggagtctcgcgggtccctcgggctgcacagggacaagtaaaggctacatccagatgccgggaatgcactgacgcccattcctggaaactgggctcccactcagcccctgggagcagcagccgccagcccctcgggacctccatctccaccctgctgagccacccgggttgggccaggatcccggcaggctgatcccgtcctccactgagacctgaaaaatggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccctctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttttaccgccatcagcaggaacaggaggctgaaggggtggctgcccctgccgacccagagatggtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatcatcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctgcagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgagagtggcatcaattggggccgtgtggtggctcttctgggcttcggctaccgtctggccctacacgtctaccagcatggcctgactggcttcctaggccaggtgacccgcttcgtggtcgacttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagccctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttgggccagtttgtggtacgaagattcttcaaatcatgactcccaagggtgccctttggggtcccggttcagacccctgcctggacttaagcgaagtctttgccttctctgttcccttgcaggggtcccccctcaagagtacagaagctttagcaagtgtgcactccagcttcggagggcccctgcgtgggggccagtcaggctgcagaggcacctcaacattgcatggtgctagtgggccctctctctgggcccaggggctgtggccgtctcctccctcagctctctgggacctccttagccctgtctgctaggcgctggggagactgataacttggggaggcaagagactgggagccacttctccccagaaagtgtttaacggttttagctttttataatacccttgtgagagcccattcccaccattctacctgaggccaggacgtctggggtgtggggattggtgggtctatgttccccaggattcagctattctggaagatcagcaccctaagagatgggactaggacctgagcctggtcctggccgtccctaagcatgtgtcccaggagcaggacctactaggagaggggggccaaggtcctgctcaactctacccctgctcccattcctccctccggccatactgcctttgcagttggactctcagggattctgggcttggggtgtggggtggggtggagtcgcagaccagagctgtctgaactcacgtgtcagaagcctccaagcctgcctcccaaggtcctctcagttctctcccttcctctctccttatagacacttgctcccaacccattcactacaggtgaaggctctcacccccatccctgggggccttgggtgagtggcctgctaaggctcctccttgcccagactacagggcttaggacttggtttgttatatcagggaaaaggagtagggagttcatctggagggttctaagtgggagaaggactatcaacaccactaggaatcccagaggtgggatcctccctcatggctctggcacagtgtaatccaggggtgtagatgggggaactgtgaatacttgaactctgttcccccaccctccatgctcctcacctgtctaggtctcctcagggtggggggtgacagtgccttctctattgggcacagcctagggtcttgggggtcaggggggagaagttcttgattcagccaaatgcagggaggggaggcagatggagcccataggccaccccctatcctctgagtgtttggaaataaactgtgcaatcccctcaccctgaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:578 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:578 -> Molecular function: GO:0031072 [heat shock protein binding] evidence: IEA
GeneID:578 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:578 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IEA
GeneID:578 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:578 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IPI
GeneID:578 -> Molecular function: GO:0051087 [chaperone binding] evidence: IEA
GeneID:578 -> Molecular function: GO:0051400 [BH domain binding] evidence: IEA
GeneID:578 -> Biological process: GO:0001782 [B cell homeostasis] evidence: IEA
GeneID:578 -> Biological process: GO:0001783 [B cell apoptotic process] evidence: IEA
GeneID:578 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IDA
GeneID:578 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IGI
GeneID:578 -> Biological process: GO:0001974 [blood vessel remodeling] evidence: IEA
GeneID:578 -> Biological process: GO:0002262 [myeloid cell homeostasis] evidence: IEA
GeneID:578 -> Biological process: GO:0002352 [B cell negative selection] evidence: IEA
GeneID:578 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:578 -> Biological process: GO:0007420 [brain development] evidence: IEA
GeneID:578 -> Biological process: GO:0007568 [aging] evidence: IEA
GeneID:578 -> Biological process: GO:0008053 [mitochondrial fusion] evidence: IEA
GeneID:578 -> Biological process: GO:0008283 [cell proliferation] evidence: IEA
GeneID:578 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA
GeneID:578 -> Biological process: GO:0008635 [activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c] evidence: IEA
GeneID:578 -> Biological process: GO:0009620 [response to fungus] evidence: IEA
GeneID:578 -> Biological process: GO:0010046 [response to mycotoxin] evidence: IEA
GeneID:578 -> Biological process: GO:0010225 [response to UV-C] evidence: IEA
GeneID:578 -> Biological process: GO:0010248 [establishment or maintenance of transmembrane electrochemical gradient] evidence: IDA
GeneID:578 -> Biological process: GO:0010332 [response to gamma radiation] evidence: IEA
GeneID:578 -> Biological process: GO:0010524 [positive regulation of calcium ion transport into cytosol] evidence: IEA
GeneID:578 -> Biological process: GO:0010629 [negative regulation of gene expression] evidence: IEA
GeneID:578 -> Biological process: GO:0014070 [response to organic cyclic compound] evidence: IEA
GeneID:578 -> Biological process: GO:0031018 [endocrine pancreas development] evidence: IEA
GeneID:578 -> Biological process: GO:0031100 [organ regeneration] evidence: IEA
GeneID:578 -> Biological process: GO:0032471 [reduction of endoplasmic reticulum calcium ion concentration] evidence: IEA
GeneID:578 -> Biological process: GO:0033137 [negative regulation of peptidyl-serine phosphorylation] evidence: IEA
GeneID:578 -> Biological process: GO:0034644 [cellular response to UV] evidence: IMP
GeneID:578 -> Biological process: GO:0034644 [cellular response to UV] evidence: ISS
GeneID:578 -> Biological process: GO:0035108 [limb morphogenesis] evidence: IEA
GeneID:578 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:578 -> Biological process: GO:0042542 [response to hydrogen peroxide] evidence: IEA
GeneID:578 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP
GeneID:578 -> Biological process: GO:0043496 [regulation of protein homodimerization activity] evidence: IDA
GeneID:578 -> Biological process: GO:0043497 [regulation of protein heterodimerization activity] evidence: IDA
GeneID:578 -> Biological process: GO:0045471 [response to ethanol] evidence: IEA
GeneID:578 -> Biological process: GO:0045862 [positive regulation of proteolysis] evidence: IDA
GeneID:578 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: IDA
GeneID:578 -> Biological process: GO:0048597 [post-embryonic camera-type eye morphogenesis] evidence: IEA
GeneID:578 -> Biological process: GO:0051726 [regulation of cell cycle] evidence: IEA
GeneID:578 -> Biological process: GO:0051881 [regulation of mitochondrial membrane potential] evidence: IDA
GeneID:578 -> Biological process: GO:0060068 [vagina development] evidence: IEA
GeneID:578 -> Biological process: GO:0070059 [intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress] evidence: IEA
GeneID:578 -> Biological process: GO:0071260 [cellular response to mechanical stimulus] evidence: IEP
GeneID:578 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IEA
GeneID:578 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: IMP
GeneID:578 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:578 -> Biological process: GO:0097202 [activation of cysteine-type endopeptidase activity] evidence: IDA
GeneID:578 -> Biological process: GO:1900103 [positive regulation of endoplasmic reticulum unfolded protein response] evidence: IMP
GeneID:578 -> Biological process: GO:1901030 [positive regulation of mitochondrial outer membrane permeabilization] evidence: TAS
GeneID:578 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:578 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS
GeneID:578 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA
GeneID:578 -> Cellular component: GO:0005829 [cytosol] evidence: IEA
GeneID:578 -> Cellular component: GO:0031307 [integral to mitochondrial outer membrane] evidence: ISS
GeneID:578 -> Cellular component: GO:0046930 [pore complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.