2024-03-29 10:10:37, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001177315 2186 bp mRNA linear PRI 29-JUN-2013 DEFINITION Homo sapiens related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4, mRNA. ACCESSION NM_001177315 VERSION NM_001177315.1 GI:293597520 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2186) AUTHORS Sherva,R., Tripodis,Y., Bennett,D.A., Chibnik,L.B., Crane,P.K., de Jager,P.L., Farrer,L.A., Saykin,A.J., Shulman,J.M. and Green,R.C. CONSRTM The GENAROADS Consortium, and The Alzheimer's Disease Neuroimaging Initiative TITLE Genome-wide association study of the rate of cognitive decline in Alzheimer's disease JOURNAL Alzheimers Dement (2013) In press PUBMED 23535033 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 2186) AUTHORS Lee,J.H., Pyon,J.K., Lee,S.H., Lee,Y.J., Kang,S.G., Kim,C.H., Kim,D.W., Nam,H.S., Park,Y.H., Jeong,D.J. and Cho,M.K. TITLE Greater expression of TC21/R-ras2 in highly aggressive malignant skin cancer JOURNAL Int. J. Dermatol. 50 (8), 956-960 (2011) PUBMED 21781067 REMARK GeneRIF: This article is the first study demonstrating expression of TC21 in human skin malignant tumors and suggests that TC21 is more expressed in highly aggressive skin tumors. REFERENCE 3 (bases 1 to 2186) AUTHORS Kim,J.M., Park,S.K., Yang,J.J., Shin,E.S., Lee,J.Y., Yun,J.Y., Kim,J.S., Park,S.S. and Jeon,B.S. TITLE SNPs in axon guidance pathway genes and susceptibility for Parkinson's disease in the Korean population JOURNAL J. Hum. Genet. 56 (2), 125-129 (2011) PUBMED 21085126 REMARK GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) REFERENCE 4 (bases 1 to 2186) AUTHORS Luo,H., Hao,X., Ge,C., Zhao,F., Zhu,M., Chen,T., Yao,M., He,X. and Li,J. TITLE TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma JOURNAL Int. J. Oncol. 37 (4), 853-859 (2010) PUBMED 20811707 REMARK GeneRIF: Suggest that TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma and is associated with tumor progression and poor prognosis in HCC. REFERENCE 5 (bases 1 to 2186) AUTHORS Calvo,F. and Crespo,P. TITLE Structural and spatial determinants regulating TC21 activation by RasGRF family nucleotide exchange factors JOURNAL Mol. Biol. Cell 20 (20), 4289-4302 (2009) PUBMED 19692568 REMARK GeneRIF: RasGRF GEFs can activate TC21 in all sublocalizations except the Golgi complex. Farnesylated TC21 can be activated by RasGRF1 & RasGRF2, but geranylgeranylated TC21 is unresponsive to RasGRF2. REFERENCE 6 (bases 1 to 2186) AUTHORS Ehrhardt,G.R., Leslie,K.B., Lee,F., Wieler,J.S. and Schrader,J.W. TITLE M-Ras, a widely expressed 29-kD homologue of p21 Ras: expression of a constitutively active mutant results in factor-independent growth of an interleukin-3-dependent cell line JOURNAL Blood 94 (7), 2433-2444 (1999) PUBMED 10498616 REFERENCE 7 (bases 1 to 2186) AUTHORS Linnemann,T., Geyer,M., Jaitner,B.K., Block,C., Kalbitzer,H.R., Wittinghofer,A. and Herrmann,C. TITLE Thermodynamic and kinetic characterization of the interaction between the Ras binding domain of AF6 and members of the Ras subfamily JOURNAL J. Biol. Chem. 274 (19), 13556-13562 (1999) PUBMED 10224125 REFERENCE 8 (bases 1 to 2186) AUTHORS Rosario,M., Paterson,H.F. and Marshall,C.J. TITLE Activation of the Raf/MAP kinase cascade by the Ras-related protein TC21 is required for the TC21-mediated transformation of NIH 3T3 cells JOURNAL EMBO J. 18 (5), 1270-1279 (1999) PUBMED 10064593 REFERENCE 9 (bases 1 to 2186) AUTHORS Chan,A.M., Miki,T., Meyers,K.A. and Aaronson,S.A. TITLE A human oncogene of the RAS superfamily unmasked by expression cDNA cloning JOURNAL Proc. Natl. Acad. Sci. U.S.A. 91 (16), 7558-7562 (1994) PUBMED 8052619 REFERENCE 10 (bases 1 to 2186) AUTHORS Drivas,G.T., Shih,A., Coutavas,E., Rush,M.G. and D'Eustachio,P. TITLE Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line JOURNAL Mol. Cell. Biol. 10 (4), 1793-1798 (1990) PUBMED 2108320 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK309550.1, BQ023701.1, AA873016.1 and BQ020351.1. Summary: This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]. Transcript Variant: This variant (4) differs in the 5' UTR and 5' coding region, compared to variant 1. The resulting isoform (b) is shorter at the N-terminus compared to isoform a. Both variants 2 and 4 encode the same isoform (b). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK309550.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-878 AK309550.1 1-878 879-1342 BQ023701.1 13-476 c 1343-1754 AA873016.1 1-412 c 1755-2186 BQ020351.1 1-432 c FEATURES Location/Qualifiers source 1..2186 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11p15.2" gene 1..2186 /gene="RRAS2" /gene_synonym="TC21" /note="related RAS viral (r-ras) oncogene homolog 2" /db_xref="GeneID:22800" /db_xref="HGNC:17271" /db_xref="MIM:600098" exon 1..248 /gene="RRAS2" /gene_synonym="TC21" /inference="alignment:Splign:1.39.8" misc_feature 207..209 /gene="RRAS2" /gene_synonym="TC21" /note="upstream in-frame stop codon" exon 249..336 /gene="RRAS2" /gene_synonym="TC21" /inference="alignment:Splign:1.39.8" exon 337..439 /gene="RRAS2" /gene_synonym="TC21" /inference="alignment:Splign:1.39.8" CDS 372..755 /gene="RRAS2" /gene_synonym="TC21" /note="isoform b is encoded by transcript variant 4; ras-like protein TC21; teratocarcinoma oncogene" /codon_start=1 /product="ras-related protein R-Ras2 isoform b" /protein_id="NP_001170786.1" /db_xref="GI:293597521" /db_xref="CCDS:CCDS44544.1" /db_xref="GeneID:22800" /db_xref="HGNC:17271" /db_xref="MIM:600098" /translation="
MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
" misc_feature <372..668 /gene="RRAS2" /gene_synonym="TC21" /note="Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases); Region: Ras_like_GTPase; cl17170" /db_xref="CDD:247724" misc_feature 399..404 /gene="RRAS2" /gene_synonym="TC21" /note="Switch II region; other site" /db_xref="CDD:206648" misc_feature 519..530 /gene="RRAS2" /gene_synonym="TC21" /note="G4 box; other site" /db_xref="CDD:206648" misc_feature 609..617 /gene="RRAS2" /gene_synonym="TC21" /note="G5 box; other site" /db_xref="CDD:206648" exon 440..548 /gene="RRAS2" /gene_synonym="TC21" /inference="alignment:Splign:1.39.8" exon 549..667 /gene="RRAS2" /gene_synonym="TC21" /inference="alignment:Splign:1.39.8" exon 668..2172 /gene="RRAS2" /gene_synonym="TC21" /inference="alignment:Splign:1.39.8" variation 879 /gene="RRAS2" /gene_synonym="TC21" /replace="c" /replace="g" /db_xref="dbSNP:8570" polyA_signal 1323..1328 /gene="RRAS2" /gene_synonym="TC21" polyA_site 1342 /gene="RRAS2" /gene_synonym="TC21" variation 1385 /gene="RRAS2" /gene_synonym="TC21" /replace="c" /replace="t" /db_xref="dbSNP:370703532" STS 1512..1706 /gene="RRAS2" /gene_synonym="TC21" /standard_name="RH40056" /db_xref="UniSTS:85592" STS 2038..2147 /gene="RRAS2" /gene_synonym="TC21" /standard_name="RH80353" /db_xref="UniSTS:92463" polyA_signal 2147..2152 /gene="RRAS2" /gene_synonym="TC21" polyA_site 2172 /gene="RRAS2" /gene_synonym="TC21" ORIGIN
attgctctggccgaggccagagacctccgggagaggctgggccaccgagccgggctttactgctccgagggtccgggcgtggggctggagctggagccccgcgcgctgcttttccagccgcctgcggccgcgccttcaccgtcggggcgatagcggtggcaacttggccgcggctccgcgtggtctccgggcttccccgcgccgcctgagccggagctgcccgcttcaagtactgtgtatttctttgttcctattttgtaacggattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacagagcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaacagtatatgaggactggcgaaggcttcctgttggtcttttcagtcacagatagaggcagttttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttcccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaagaaggacaacagttagcacggcagcttaaggtaacatacatggaggcatcagcaaagattaggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagagcaggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccattgtgtcattttctagaatcccttcagttttagctaccaacggccaggaaaagccctcatcttctctttctctcctcagtttacatcttgttggtacctttctagccttagacaaatgatcaccatgttagccttagacgaagaagctggctagtcctttctgtgaagctaatacaatggtcatttccagacaaatttaaaggaaacactaaggctgcttcaaagattatctgattcctttaaaatatatgtctatatacacagacatgctctttttttaagtgcttacattttaatagagatgaatcagttttggaatctaagctgtttgccaagctgaagctacaggttgtgaaataatttttaacttttggaatcatactgcctactgttactctaaatagaaatatagggttttttttaatgtgaatttttgcctatctttaaacatttcaatgtcagcctttgttaaccttaaatacactgaattgaatctacaaaagtgaaccatctcagacctttactgatactacaacttttgttttctgatggccaaaataccaaatgcctgttgtatttatggattaaaaactgcttataaaaccctgtgttactactcctactcttggagatgataatattctatgtggtcaaatatttggactcatttaggacttagatatttcagtgtacttgattttttaatttaactctttttcacagccacgctaagggtaaaaaggaataatttccttctgtcttccttttcaagtatttctgggtaagggattcaaaaaactaaaactgtttttgtttgtaatataaaatatggaattgatctttccagggtcagagatgattaatgtttttgctatatacttttatacattattttcttatcaaactagttaacaagtatttttatatgtttgtaagcagatatgctttcatagcataccttgtgtatatgtaaagataagtatttaattctcactgttcacttttaactgacaaagaaaaacaagtggaaactacagaaactgtggtagaacttttacttgctggtctggtcttggttgtacccatctttggccagtcacataactactcaagaaaccttcccaatagagtacaacaggatgagactctgaaatcactttcagtattccctgctagatattgattgttatttcaagtattaagtgtaagcttttaatggataattagtataactgtggatggcatctgattttgtttttaattctgtggattgtgtttaagcaattcaatagtatgttcctgattttgagatgctaagtggtattgcacagttgtcactttatcaagtgtgtacaacagtcccatgaagtttatagagcatacccttgtatagcttcaggtgctagaattaaaattgatctgttatcacaagaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:22800 -> Molecular function: GO:0003924 [GTPase activity] evidence: IEA GeneID:22800 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:22800 -> Molecular function: GO:0005525 [GTP binding] evidence: IEA GeneID:22800 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: IEA GeneID:22800 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IEA GeneID:22800 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: NAS GeneID:22800 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.