2024-04-19 16:45:34, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001174105 1540 bp mRNA linear PRI 15-JUL-2013 DEFINITION Homo sapiens CD14 molecule (CD14), transcript variant 4, mRNA. ACCESSION NM_001174105 VERSION NM_001174105.1 GI:291575164 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1540) AUTHORS Ranoa,D.R., Kelley,S.L. and Tapping,R.I. TITLE Human lipopolysaccharide-binding protein (LBP) and CD14 independently deliver triacylated lipoproteins to Toll-like receptor 1 (TLR1) and TLR2 and enhance formation of the ternary signaling complex JOURNAL J. Biol. Chem. 288 (14), 9729-9741 (2013) PUBMED 23430250 REMARK GeneRIF: Human lipopolysaccharide-binding protein (LBP) and CD14 independently deliver triacylated lipoproteins to Toll-like receptor 1 (TLR1) and TLR2 and enhance formation of the ternary signaling complex REFERENCE 2 (bases 1 to 1540) AUTHORS Kelley,S.L., Lukk,T., Nair,S.K. and Tapping,R.I. TITLE The crystal structure of human soluble CD14 reveals a bent solenoid with a hydrophobic amino-terminal pocket JOURNAL J. Immunol. 190 (3), 1304-1311 (2013) PUBMED 23264655 REMARK GeneRIF: The x-ray crystal structure of human CD14 contains an expanded pocket and alternative rim residues that are likely to be important for LPS binding and cell activation. . REFERENCE 3 (bases 1 to 1540) AUTHORS Guo,S., Al-Sadi,R., Said,H.M. and Ma,T.Y. TITLE Lipopolysaccharide causes an increase in intestinal tight junction permeability in vitro and in vivo by inducing enterocyte membrane expression and localization of TLR-4 and CD14 JOURNAL Am. J. Pathol. 182 (2), 375-387 (2013) PUBMED 23201091 REMARK GeneRIF: These studies show for the first time that lipopolysaccharide causes an increase in intestinal permeability via an intracellular mechanism involving TLR-4-dependent up-regulation of CD14 membrane expression. REFERENCE 4 (bases 1 to 1540) AUTHORS Munthe-Kaas,M.C., Bertelsen,R.J., Torjussen,T.M., Hjorthaug,H.S., Undlien,D.E., Lyle,R., Gervin,K., Granum,B., Mowinckel,P., Carlsen,K.H. and Carlsen,K.C. TITLE Pet keeping and tobacco exposure influence CD14 methylation in childhood JOURNAL Pediatr Allergy Immunol 23 (8), 747-754 (2012) PUBMED 23194293 REMARK GeneRIF: Pet keeping and tobacco smoke exposure small were associated with a smaller increase in CD14 methylation during childhood and lower CD14 methylation at 10 yr., indicating a CD14 gene-environemnt interaction. REFERENCE 5 (bases 1 to 1540) AUTHORS Sarvari,M., Hrabovszky,E., Kallo,I., Solymosi,N., Liko,I., Berchtold,N., Cotman,C. and Liposits,Z. TITLE Menopause leads to elevated expression of macrophage-associated genes in the aging frontal cortex: rat and human studies identify strikingly similar changes JOURNAL J Neuroinflammation 9, 264 (2012) PUBMED 23206327 REMARK GeneRIF: This study analysis revealed up-regulation of CD14, CD18, CD45, TLR2, TLR4, CD74, C1q, C3, CCL2, and down-regulation of CD36, CX3CR1, CX3CL1 and CD200 in postmenopausal women Publication Status: Online-Only REFERENCE 6 (bases 1 to 1540) AUTHORS Schumann,R.R., Leong,S.R., Flaggs,G.W., Gray,P.W., Wright,S.D., Mathison,J.C., Tobias,P.S. and Ulevitch,R.J. TITLE Structure and function of lipopolysaccharide binding protein JOURNAL Science 249 (4975), 1429-1431 (1990) PUBMED 2402637 REFERENCE 7 (bases 1 to 1540) AUTHORS Setoguchi,M., Nasu,N., Yoshida,S., Higuchi,Y., Akizuki,S. and Yamamoto,S. TITLE Mouse and human CD14 (myeloid cell-specific leucine-rich glycoprotein) primary structure deduced from cDNA clones JOURNAL Biochim. Biophys. Acta 1008 (2), 213-222 (1989) PUBMED 2472171 REFERENCE 8 (bases 1 to 1540) AUTHORS Simmons,D.L., Tan,S., Tenen,D.G., Nicholson-Weller,A. and Seed,B. TITLE Monocyte antigen CD14 is a phospholipid anchored membrane protein JOURNAL Blood 73 (1), 284-289 (1989) PUBMED 2462937 REFERENCE 9 (bases 1 to 1540) AUTHORS Ferrero,E. and Goyert,S.M. TITLE Nucleotide sequence of the gene encoding the monocyte differentiation antigen, CD14 JOURNAL Nucleic Acids Res. 16 (9), 4173 (1988) PUBMED 2453848 REFERENCE 10 (bases 1 to 1540) AUTHORS Goyert,S.M., Ferrero,E., Rettig,W.J., Yenamandra,A.K., Obata,F. and Le Beau,M.M. TITLE The CD14 monocyte differentiation antigen maps to a region encoding growth factors and receptors JOURNAL Science 239 (4839), 497-500 (1988) PUBMED 2448876 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA426297.1, DA269805.1, BC010507.2 and W74441.1. Summary: The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Mar 2010]. Transcript Variant: This variant (4) differs in the 5' UTR compared to variant 1. Variants 1-4 encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: DA269805.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-150 DA426297.1 1-150 151-412 DA269805.1 127-388 413-1523 BC010507.2 247-1357 1524-1540 W74441.1 1-17 c FEATURES Location/Qualifiers source 1..1540 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="5" /map="5q31.1" gene 1..1540 /gene="CD14" /note="CD14 molecule" /db_xref="GeneID:929" /db_xref="HGNC:1628" /db_xref="MIM:158120" exon 1..150 /gene="CD14" /inference="alignment:Splign:1.39.8" exon 151..274 /gene="CD14" /inference="alignment:Splign:1.39.8" STS 200..483 /gene="CD14" /standard_name="PMC148872P1" /db_xref="UniSTS:271024" misc_feature 218..220 /gene="CD14" /note="upstream in-frame stop codon" CDS 272..1399 /gene="CD14" /note="monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein" /codon_start=1 /product="monocyte differentiation antigen CD14 precursor" /protein_id="NP_001167576.1" /db_xref="GI:291575165" /db_xref="CCDS:CCDS4232.1" /db_xref="GeneID:929" /db_xref="HGNC:1628" /db_xref="MIM:158120" /translation="
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
" sig_peptide 272..328 /gene="CD14" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 329..1396 /gene="CD14" /product="monocyte differentiation antigen CD14" misc_feature 395..538 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: Ligand-binding pocket rim" misc_feature 518..625 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 2" misc_feature 626..703 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 3" misc_feature 704..787 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 4" misc_feature 788..859 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 5" misc_feature 860..943 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 6" misc_feature 944..1024 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 7" misc_feature 1025..1105 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 8" misc_feature 1106..1168 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 9" misc_feature 1169..1234 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 10" misc_feature 1235..1318 /gene="CD14" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P08571.2); Region: LRR 11" exon 275..1527 /gene="CD14" /inference="alignment:Splign:1.39.8" variation 286 /gene="CD14" /replace="c" /replace="t" /db_xref="dbSNP:3138079" STS 360..525 /gene="CD14" /standard_name="RH17946" /db_xref="UniSTS:4037" STS 461..887 /gene="CD14" /standard_name="PMC108311P1" /db_xref="UniSTS:270134" STS 691..1256 /gene="CD14" /standard_name="PMC98826P1" /db_xref="UniSTS:273681" variation 881 /gene="CD14" /replace="a" /replace="g" /db_xref="dbSNP:2228049" STS 1084..1349 /gene="CD14" /standard_name="PMC136845P1" /db_xref="UniSTS:270804" variation 1132 /gene="CD14" /replace="g" /replace="t" /db_xref="dbSNP:13763" STS 1227..1313 /gene="CD14" /standard_name="RH67904" /db_xref="UniSTS:34631" STS 1262..1405 /gene="CD14" /standard_name="RH11569" /db_xref="UniSTS:73130" STS 1292..1443 /gene="CD14" /standard_name="G62118" /db_xref="UniSTS:139164" variation 1491 /gene="CD14" /replace="a" /replace="t" /db_xref="dbSNP:5744456" polyA_signal 1505..1510 /gene="CD14" variation 1519 /gene="CD14" /replace="c" /replace="g" /db_xref="dbSNP:3776138" polyA_site 1527 /gene="CD14" ORIGIN
aattctaccccccttggtgccaacagatgaggttcacaatctcttccacaaaacatgcagttaaatatctgaggatattcagggacttggatttggtggcaggagatcaacataaaccaagacaaggaagaagtcaaagaaatgaatcaaaggcagccgaagagttcacaagtgtgaagcctggaagccggcgggtgccgctgtgtaggaaagaagctaaagcacttccagagcctgtccggagctcagaggttcggaagacttatcgaccatggagcgcgcgtcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgaccacgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaacctcagcccgactggtccgaagccttccagtgtgtgtctgcagtagaggtggagatccatgccggcggtctcaacctagagccgtttctaaagcgcgtcgatgcggacgccgacccgcggcagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtgggagccgcacaggttcctgctcagctactggtaggcgccctgcgtgtgctagcgtactcccgcctcaaggaactgacgctcgaggacctaaagataaccggcaccatgcctccgctgcctctggaagccacaggacttgcactttccagcttgcgcctacgcaacgtgtcgtgggcgacagggcgttcttggctcgccgagctgcagcagtggctcaagccaggcctcaaggtactgagcattgcccaagcacactcgcctgccttttcctgcgaacaggttcgcgccttcccggcccttaccagcctagacctgtctgacaatcctggactgggcgaacgcggactgatggcggctctctgtccccacaagttcccggccatccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtgtgcgccgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcgctgcgcgccaccgtaaaccctagcgctccgagatgcatgtggtccagcgccctgaactccctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccagccaagctcagagtgctcgatctcagctgcaacagactgaacagggcgccgcagcctgacgagctgcccgaggtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccacgagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggggtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaagatccaagacagaataatgaatggactcaaactgccttggcttcaggggagtcccgtcaggacgttgaggacttttcgaccaattcaaccctttgccccacctttattaaaatcttaaacaacgggtcaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:929 -> Molecular function: GO:0001530 [lipopolysaccharide binding] evidence: IDA GeneID:929 -> Molecular function: GO:0001847 [opsonin receptor activity] evidence: TAS GeneID:929 -> Molecular function: GO:0016019 [peptidoglycan receptor activity] evidence: TAS GeneID:929 -> Molecular function: GO:0070891 [lipoteichoic acid binding] evidence: IDA GeneID:929 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0006909 [phagocytosis] evidence: TAS GeneID:929 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:929 -> Biological process: GO:0006954 [inflammatory response] evidence: IEA GeneID:929 -> Biological process: GO:0007166 [cell surface receptor signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: TAS GeneID:929 -> Biological process: GO:0009408 [response to heat] evidence: IEA GeneID:929 -> Biological process: GO:0032760 [positive regulation of tumor necrosis factor production] evidence: IDA GeneID:929 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS GeneID:929 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:929 -> Biological process: GO:0045807 [positive regulation of endocytosis] evidence: IEA GeneID:929 -> Biological process: GO:0050715 [positive regulation of cytokine secretion] evidence: IEA GeneID:929 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IDA GeneID:929 -> Biological process: GO:0071223 [cellular response to lipoteichoic acid] evidence: IDA GeneID:929 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS GeneID:929 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA GeneID:929 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS GeneID:929 -> Cellular component: GO:0009986 [cell surface] evidence: IEA GeneID:929 -> Cellular component: GO:0010008 [endosome membrane] evidence: TAS GeneID:929 -> Cellular component: GO:0031225 [anchored to membrane] evidence: IEA GeneID:929 -> Cellular component: GO:0045121 [membrane raft] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.