Home |
Help |
Advanced search
2024-04-20 01:22:51, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001174104 1661 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens CD14 molecule (CD14), transcript variant 3, mRNA.
ACCESSION NM_001174104
VERSION NM_001174104.1 GI:291575162
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1661)
AUTHORS Ranoa,D.R., Kelley,S.L. and Tapping,R.I.
TITLE Human lipopolysaccharide-binding protein (LBP) and CD14
independently deliver triacylated lipoproteins to Toll-like
receptor 1 (TLR1) and TLR2 and enhance formation of the ternary
signaling complex
JOURNAL J. Biol. Chem. 288 (14), 9729-9741 (2013)
PUBMED 23430250
REMARK GeneRIF: Human lipopolysaccharide-binding protein (LBP) and CD14
independently deliver triacylated lipoproteins to Toll-like
receptor 1 (TLR1) and TLR2 and enhance formation of the ternary
signaling complex
REFERENCE 2 (bases 1 to 1661)
AUTHORS Kelley,S.L., Lukk,T., Nair,S.K. and Tapping,R.I.
TITLE The crystal structure of human soluble CD14 reveals a bent solenoid
with a hydrophobic amino-terminal pocket
JOURNAL J. Immunol. 190 (3), 1304-1311 (2013)
PUBMED 23264655
REMARK GeneRIF: The x-ray crystal structure of human CD14 contains an
expanded pocket and alternative rim residues that are likely to be
important for LPS binding and cell activation. .
REFERENCE 3 (bases 1 to 1661)
AUTHORS Guo,S., Al-Sadi,R., Said,H.M. and Ma,T.Y.
TITLE Lipopolysaccharide causes an increase in intestinal tight junction
permeability in vitro and in vivo by inducing enterocyte membrane
expression and localization of TLR-4 and CD14
JOURNAL Am. J. Pathol. 182 (2), 375-387 (2013)
PUBMED 23201091
REMARK GeneRIF: These studies show for the first time that
lipopolysaccharide causes an increase in intestinal permeability
via an intracellular mechanism involving TLR-4-dependent
up-regulation of CD14 membrane expression.
REFERENCE 4 (bases 1 to 1661)
AUTHORS Munthe-Kaas,M.C., Bertelsen,R.J., Torjussen,T.M., Hjorthaug,H.S.,
Undlien,D.E., Lyle,R., Gervin,K., Granum,B., Mowinckel,P.,
Carlsen,K.H. and Carlsen,K.C.
TITLE Pet keeping and tobacco exposure influence CD14 methylation in
childhood
JOURNAL Pediatr Allergy Immunol 23 (8), 747-754 (2012)
PUBMED 23194293
REMARK GeneRIF: Pet keeping and tobacco smoke exposure small were
associated with a smaller increase in CD14 methylation during
childhood and lower CD14 methylation at 10 yr., indicating a CD14
gene-environemnt interaction.
REFERENCE 5 (bases 1 to 1661)
AUTHORS Sarvari,M., Hrabovszky,E., Kallo,I., Solymosi,N., Liko,I.,
Berchtold,N., Cotman,C. and Liposits,Z.
TITLE Menopause leads to elevated expression of macrophage-associated
genes in the aging frontal cortex: rat and human studies identify
strikingly similar changes
JOURNAL J Neuroinflammation 9, 264 (2012)
PUBMED 23206327
REMARK GeneRIF: This study analysis revealed up-regulation of CD14, CD18,
CD45, TLR2, TLR4, CD74, C1q, C3, CCL2, and down-regulation of CD36,
CX3CR1, CX3CL1 and CD200 in postmenopausal women
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1661)
AUTHORS Schumann,R.R., Leong,S.R., Flaggs,G.W., Gray,P.W., Wright,S.D.,
Mathison,J.C., Tobias,P.S. and Ulevitch,R.J.
TITLE Structure and function of lipopolysaccharide binding protein
JOURNAL Science 249 (4975), 1429-1431 (1990)
PUBMED 2402637
REFERENCE 7 (bases 1 to 1661)
AUTHORS Setoguchi,M., Nasu,N., Yoshida,S., Higuchi,Y., Akizuki,S. and
Yamamoto,S.
TITLE Mouse and human CD14 (myeloid cell-specific leucine-rich
glycoprotein) primary structure deduced from cDNA clones
JOURNAL Biochim. Biophys. Acta 1008 (2), 213-222 (1989)
PUBMED 2472171
REFERENCE 8 (bases 1 to 1661)
AUTHORS Simmons,D.L., Tan,S., Tenen,D.G., Nicholson-Weller,A. and Seed,B.
TITLE Monocyte antigen CD14 is a phospholipid anchored membrane protein
JOURNAL Blood 73 (1), 284-289 (1989)
PUBMED 2462937
REFERENCE 9 (bases 1 to 1661)
AUTHORS Ferrero,E. and Goyert,S.M.
TITLE Nucleotide sequence of the gene encoding the monocyte
differentiation antigen, CD14
JOURNAL Nucleic Acids Res. 16 (9), 4173 (1988)
PUBMED 2453848
REFERENCE 10 (bases 1 to 1661)
AUTHORS Goyert,S.M., Ferrero,E., Rettig,W.J., Yenamandra,A.K., Obata,F. and
Le Beau,M.M.
TITLE The CD14 monocyte differentiation antigen maps to a region encoding
growth factors and receptors
JOURNAL Science 239 (4839), 497-500 (1988)
PUBMED 2448876
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA426297.1, BP300412.1,
BC010507.2 and W74441.1.
Summary: The protein encoded by this gene is a surface antigen that
is preferentially expressed on monocytes/macrophages. It cooperates
with other proteins to mediate the innate immune response to
bacterial lipopolysaccharide. Alternative splicing results in
multiple transcript variants encoding the same protein. [provided
by RefSeq, Mar 2010].
Transcript Variant: This variant (3) differs in the 5' UTR compared
to variant 1. Variants 1-4 encode the same protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BP300412.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025090, ERS025091 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-171 DA426297.1 1-171
172-557 BP300412.1 171-556
558-1644 BC010507.2 271-1357
1645-1661 W74441.1 1-17 c
FEATURES Location/Qualifiers
source 1..1661
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
/map="5q31.1"
gene 1..1661
/gene="CD14"
/note="CD14 molecule"
/db_xref="GeneID:929"
/db_xref="HGNC:1628"
/db_xref="MIM:158120"
exon 1..171
/gene="CD14"
/inference="alignment:Splign:1.39.8"
exon 172..395
/gene="CD14"
/inference="alignment:Splign:1.39.8"
variation 258
/gene="CD14"
/replace="a"
/replace="g"
/db_xref="dbSNP:34424920"
STS 321..604
/gene="CD14"
/standard_name="PMC148872P1"
/db_xref="UniSTS:271024"
misc_feature 339..341
/gene="CD14"
/note="upstream in-frame stop codon"
CDS 393..1520
/gene="CD14"
/note="monocyte differentiation antigen CD14; myeloid
cell-specific leucine-rich glycoprotein"
/codon_start=1
/product="monocyte differentiation antigen CD14 precursor"
/protein_id="NP_001167575.1"
/db_xref="GI:291575163"
/db_xref="CCDS:CCDS4232.1"
/db_xref="GeneID:929"
/db_xref="HGNC:1628"
/db_xref="MIM:158120"
/translation="
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
"
sig_peptide 393..449
/gene="CD14"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 450..1517
/gene="CD14"
/product="monocyte differentiation antigen CD14"
misc_feature 516..659
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: Ligand-binding pocket rim"
misc_feature 639..746
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 2"
misc_feature 747..824
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 3"
misc_feature 825..908
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 4"
misc_feature 909..980
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 5"
misc_feature 981..1064
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 6"
misc_feature 1065..1145
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 7"
misc_feature 1146..1226
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 8"
misc_feature 1227..1289
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 9"
misc_feature 1290..1355
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 10"
misc_feature 1356..1439
/gene="CD14"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08571.2);
Region: LRR 11"
exon 396..1648
/gene="CD14"
/inference="alignment:Splign:1.39.8"
variation 407
/gene="CD14"
/replace="c"
/replace="t"
/db_xref="dbSNP:3138079"
STS 481..646
/gene="CD14"
/standard_name="RH17946"
/db_xref="UniSTS:4037"
STS 582..1008
/gene="CD14"
/standard_name="PMC108311P1"
/db_xref="UniSTS:270134"
STS 812..1377
/gene="CD14"
/standard_name="PMC98826P1"
/db_xref="UniSTS:273681"
variation 1002
/gene="CD14"
/replace="a"
/replace="g"
/db_xref="dbSNP:2228049"
STS 1205..1470
/gene="CD14"
/standard_name="PMC136845P1"
/db_xref="UniSTS:270804"
variation 1253
/gene="CD14"
/replace="g"
/replace="t"
/db_xref="dbSNP:13763"
STS 1348..1434
/gene="CD14"
/standard_name="RH67904"
/db_xref="UniSTS:34631"
STS 1383..1526
/gene="CD14"
/standard_name="RH11569"
/db_xref="UniSTS:73130"
STS 1413..1564
/gene="CD14"
/standard_name="G62118"
/db_xref="UniSTS:139164"
variation 1612
/gene="CD14"
/replace="a"
/replace="t"
/db_xref="dbSNP:5744456"
polyA_signal 1626..1631
/gene="CD14"
variation 1640
/gene="CD14"
/replace="c"
/replace="g"
/db_xref="dbSNP:3776138"
polyA_site 1648
/gene="CD14"
ORIGIN
aattctaccccccttggtgccaacagatgaggttcacaatctcttccacaaaacatgcagttaaatatctgaggatattcagggacttggatttggtggcaggagatcaacataaaccaagacaaggaagaagtcaaagaaatgaatcaagtagattctctgggatataaggaaaggaagggggctggctcggaggaagagaggtggggaggtgatcagggttcacagaggagggaactgaatgacatcccaggattacataaactgtcagaggcagccgaagagttcacaagtgtgaagcctggaagccggcgggtgccgctgtgtaggaaagaagctaaagcacttccagagcctgtccggagctcagaggttcggaagacttatcgaccatggagcgcgcgtcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgaccacgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaacctcagcccgactggtccgaagccttccagtgtgtgtctgcagtagaggtggagatccatgccggcggtctcaacctagagccgtttctaaagcgcgtcgatgcggacgccgacccgcggcagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtgggagccgcacaggttcctgctcagctactggtaggcgccctgcgtgtgctagcgtactcccgcctcaaggaactgacgctcgaggacctaaagataaccggcaccatgcctccgctgcctctggaagccacaggacttgcactttccagcttgcgcctacgcaacgtgtcgtgggcgacagggcgttcttggctcgccgagctgcagcagtggctcaagccaggcctcaaggtactgagcattgcccaagcacactcgcctgccttttcctgcgaacaggttcgcgccttcccggcccttaccagcctagacctgtctgacaatcctggactgggcgaacgcggactgatggcggctctctgtccccacaagttcccggccatccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtgtgcgccgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcgctgcgcgccaccgtaaaccctagcgctccgagatgcatgtggtccagcgccctgaactccctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccagccaagctcagagtgctcgatctcagctgcaacagactgaacagggcgccgcagcctgacgagctgcccgaggtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccacgagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggggtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaagatccaagacagaataatgaatggactcaaactgccttggcttcaggggagtcccgtcaggacgttgaggacttttcgaccaattcaaccctttgccccacctttattaaaatcttaaacaacgggtcaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:929 -> Molecular function: GO:0001530 [lipopolysaccharide binding] evidence: IDA
GeneID:929 -> Molecular function: GO:0001847 [opsonin receptor activity] evidence: TAS
GeneID:929 -> Molecular function: GO:0016019 [peptidoglycan receptor activity] evidence: TAS
GeneID:929 -> Molecular function: GO:0070891 [lipoteichoic acid binding] evidence: IDA
GeneID:929 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0006909 [phagocytosis] evidence: TAS
GeneID:929 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:929 -> Biological process: GO:0006954 [inflammatory response] evidence: IEA
GeneID:929 -> Biological process: GO:0007166 [cell surface receptor signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: TAS
GeneID:929 -> Biological process: GO:0009408 [response to heat] evidence: IEA
GeneID:929 -> Biological process: GO:0032760 [positive regulation of tumor necrosis factor production] evidence: IDA
GeneID:929 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS
GeneID:929 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:929 -> Biological process: GO:0045807 [positive regulation of endocytosis] evidence: IEA
GeneID:929 -> Biological process: GO:0050715 [positive regulation of cytokine secretion] evidence: IEA
GeneID:929 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IDA
GeneID:929 -> Biological process: GO:0071223 [cellular response to lipoteichoic acid] evidence: IDA
GeneID:929 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:929 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
GeneID:929 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:929 -> Cellular component: GO:0009986 [cell surface] evidence: IEA
GeneID:929 -> Cellular component: GO:0010008 [endosome membrane] evidence: TAS
GeneID:929 -> Cellular component: GO:0031225 [anchored to membrane] evidence: IEA
GeneID:929 -> Cellular component: GO:0045121 [membrane raft] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.