Home |
Help |
Advanced search
2024-04-26 23:51:57, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001170407 1742 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens cyclin-dependent kinase 1 (CDK1), transcript variant
5, mRNA.
ACCESSION NM_001170407
VERSION NM_001170407.1 GI:281427279
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1742)
AUTHORS Kabuta,T., Mitsui,T., Takahashi,M., Fujiwara,Y., Kabuta,C.,
Konya,C., Tsuchiya,Y., Hatanaka,Y., Uchida,K., Hohjoh,H. and
Wada,K.
TITLE Ubiquitin C-terminal hydrolase L1 (UCH-L1) acts as a novel
potentiator of cyclin-dependent kinases to enhance cell
proliferation independently of its hydrolase activity
JOURNAL J. Biol. Chem. 288 (18), 12615-12626 (2013)
PUBMED 23543736
REMARK GeneRIF: UCH-L1 physically interacts with CDK1, CDK4, and CDK5,
enhancing their kinase activity.
REFERENCE 2 (bases 1 to 1742)
AUTHORS Schofield,A.V., Gamell,C., Suryadinata,R., Sarcevic,B. and
Bernard,O.
TITLE Tubulin polymerization promoting protein 1 (Tppp1) phosphorylation
by Rho-associated coiled-coil kinase (rock) and cyclin-dependent
kinase 1 (Cdk1) inhibits microtubule dynamics to increase cell
proliferation
JOURNAL J. Biol. Chem. 288 (11), 7907-7917 (2013)
PUBMED 23355470
REMARK GeneRIF: dual Rock and Cdk phosphorylation of Tppp1 inhibits its
regulation of the cell cycle to increase cell proliferation
REFERENCE 3 (bases 1 to 1742)
AUTHORS Cho,H.J., Oh,Y.J., Han,S.H., Chung,H.J., Kim,C.H., Lee,N.S.,
Kim,W.J., Choi,J.M. and Kim,H.
TITLE Cdk1 protein-mediated phosphorylation of receptor-associated
protein 80 (RAP80) serine 677 modulates DNA damage-induced G2/M
checkpoint and cell survival
JOURNAL J. Biol. Chem. 288 (6), 3768-3776 (2013)
PUBMED 23264621
REMARK GeneRIF: post-translational phosphorylation of RAP80 by the
Cdk1-cyclin B(1) complex is important for RAP80 functional
sensitivity to IR and G(2)/M checkpoint control.
REFERENCE 4 (bases 1 to 1742)
AUTHORS Zhao,X.F., Zhao,M.Y., Chai,L., Kukuruga,D., Tan,M. and Stass,S.A.
TITLE Amplified RPS6KB1 and CDC2 genes are potential biomarkers for
aggressive HIV+/EBV+ diffuse large B-cell lymphomas
JOURNAL Int J Clin Exp Pathol 6 (2), 148-154 (2013)
PUBMED 23330000
REMARK GeneRIF: HIV+/EBV+ aggressive diffuse large B-cell lymphoma could
be potentially treated by targeting RPS6KB1 and CDC2 genes.
REFERENCE 5 (bases 1 to 1742)
AUTHORS Parker,L.L. and Piwnica-Worms,H.
TITLE Inactivation of the p34cdc2-cyclin B complex by the human WEE1
tyrosine kinase
JOURNAL Science 257 (5078), 1955-1957 (1992)
PUBMED 1384126
REFERENCE 6 (bases 1 to 1742)
AUTHORS Koff,A., Giordano,A., Desai,D., Yamashita,K., Harper,J.W.,
Elledge,S., Nishimoto,T., Morgan,D.O., Franza,B.R. and Roberts,J.M.
TITLE Formation and activation of a cyclin E-cdk2 complex during the G1
phase of the human cell cycle
JOURNAL Science 257 (5077), 1689-1694 (1992)
PUBMED 1388288
REFERENCE 7 (bases 1 to 1742)
AUTHORS Dutta,A. and Stillman,B.
TITLE cdc2 family kinases phosphorylate a human cell DNA replication
factor, RPA, and activate DNA replication
JOURNAL EMBO J. 11 (6), 2189-2199 (1992)
PUBMED 1318195
REFERENCE 8 (bases 1 to 1742)
AUTHORS Azzi,L., Meijer,L., Reed,S.I., Pidikiti,R. and Tung,H.Y.
TITLE Interaction between the cell-cycle-control proteins p34cdc2 and
p9CKShs2. Evidence for two cooperative binding domains in p9CKShs2
JOURNAL Eur. J. Biochem. 203 (3), 353-360 (1992)
PUBMED 1310466
REFERENCE 9 (bases 1 to 1742)
AUTHORS Nazarenko,S.A., Ostroverhova,N.V. and Spurr,N.K.
TITLE Regional assignment of the human cell cycle control gene CDC2 to
chromosome 10q21 by in situ hybridization
JOURNAL Hum. Genet. 87 (5), 621-622 (1991)
PUBMED 1916766
REFERENCE 10 (bases 1 to 1742)
AUTHORS Lee,M.G. and Nurse,P.
TITLE Complementation used to clone a human homologue of the fission
yeast cell cycle control gene cdc2
JOURNAL Nature 327 (6117), 31-35 (1987)
PUBMED 3553962
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BG723076.1, AK295741.1,
AA459484.1 and AC022390.9.
Summary: The protein encoded by this gene is a member of the
Ser/Thr protein kinase family. This protein is a catalytic subunit
of the highly conserved protein kinase complex known as M-phase
promoting factor (MPF), which is essential for G1/S and G2/M phase
transitions of eukaryotic cell cycle. Mitotic cyclins stably
associate with this protein and function as regulatory subunits.
The kinase activity of this protein is controlled by cyclin
accumulation and destruction through the cell cycle. The
phosphorylation and dephosphorylation of this protein also play
important regulatory roles in cell cycle control. Alternatively
spliced transcript variants encoding different isoforms have been
found for this gene. [provided by RefSeq, Mar 2009].
Transcript Variant: This variant (5) differs in the 3' coding
region and 3' UTR, compared to variant 1. The resulting isoform (4)
has a distinct C-terminus and is shorter than isoform 1. Both
variants 4 and 5 encode the same isoform (4).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: CN397440.1, AW968471.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025085 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-117 BG723076.1 6-122
118-691 AK295741.1 96-669
692-1028 AA459484.1 103-439 c
1029-1228 AK295741.1 1007-1206
1229-1229 AC022390.9 119557-119557
1230-1742 AK295741.1 1208-1720
FEATURES Location/Qualifiers
source 1..1742
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="10"
/map="10q21.1"
gene 1..1742
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/note="cyclin-dependent kinase 1"
/db_xref="GeneID:983"
/db_xref="HGNC:1722"
/db_xref="MIM:116940"
exon 1..117
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/inference="alignment:Splign:1.39.8"
variation 59
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="g"
/db_xref="dbSNP:3213016"
variation 60
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="g"
/db_xref="dbSNP:138297542"
variation 67
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:185105988"
exon 118..179
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/inference="alignment:Splign:1.39.8"
misc_feature 134..136
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/note="upstream in-frame stop codon"
variation 134
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="g"
/replace="t"
/db_xref="dbSNP:3213028"
CDS 143..472
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/EC_number="2.7.11.23"
/EC_number="2.7.11.22"
/note="isoform 4 is encoded by transcript variant 5; cell
division cycle 2, G1 to S and G2 to M; cell division
control protein 2 homolog; p34 protein kinase; cell cycle
controller CDC2; cell division protein kinase 1"
/codon_start=1
/product="cyclin-dependent kinase 1 isoform 4"
/protein_id="NP_001163878.1"
/db_xref="GI:281427280"
/db_xref="GeneID:983"
/db_xref="HGNC:1722"
/db_xref="MIM:116940"
/translation="
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKVKA
"
misc_feature 143..145
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylmethionine; propagated from
UniProtKB/Swiss-Prot (P06493.3); acetylation site"
misc_feature 149..>460
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/note="Protein Kinases, catalytic domain; Region:
PKc_like; cl09925"
/db_xref="CDD:214163"
misc_feature 152..154
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine, by PKR; propagated from
UniProtKB/Swiss-Prot (P06493.3); phosphorylation site"
misc_feature 158..160
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P06493.3); acetylation site"
misc_feature order(170..184,194..196,233..235,239..241,332..334,
380..391,398..400,404..406)
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/note="active site"
/db_xref="CDD:173623"
misc_feature order(170..184,194..196,233..235,239..241,332..334,
380..391,398..400)
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173623"
misc_feature 182..184
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by PKMYT1; propagated from
UniProtKB/Swiss-Prot (P06493.3); phosphorylation site"
misc_feature 185..187
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine, by PKMYT1, WEE1, WEE2 and
PKC/PRKCD; propagated from UniProtKB/Swiss-Prot
(P06493.3); phosphorylation site"
misc_feature 197..199
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine; propagated from
UniProtKB/Swiss-Prot (P06493.3); phosphorylation site"
misc_feature 257..259
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P06493.3); phosphorylation site"
misc_feature 371..373
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine; propagated from
UniProtKB/Swiss-Prot (P06493.3); phosphorylation site"
variation 177..178
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace=""
/replace="a"
/db_xref="dbSNP:67885060"
exon 180..336
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/inference="alignment:Splign:1.39.8"
variation 210
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:111992007"
variation 225
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:377117179"
variation 287
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:142650572"
variation 317
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:8755"
exon 337..1742
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/inference="alignment:Splign:1.39.8"
STS 348..542
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/standard_name="SHGC-64950"
/db_xref="UniSTS:72564"
variation 356
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:11540347"
variation 370
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:148632129"
variation 412
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:144445383"
variation 413
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:147689519"
variation 439
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:373485880"
variation 440
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:374332309"
variation 495
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:142079607"
variation 670
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:12415622"
variation 692
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2261327"
variation 736
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:3213049"
variation 741
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:3213050"
variation 752
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="c"
/db_xref="dbSNP:140037449"
variation 817
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373026408"
variation 827
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="g"
/replace="t"
/db_xref="dbSNP:149852034"
variation 1004
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="g"
/replace="t"
/db_xref="dbSNP:12220787"
variation 1028
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:3213051"
variation 1088
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:147945484"
variation 1184
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:3213052"
variation 1196
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373908539"
variation 1229
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2456774"
variation 1309
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:181575957"
variation 1363
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:113978841"
variation 1409
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141764318"
variation 1431
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="g"
/db_xref="dbSNP:369360059"
variation 1460
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:116168241"
variation 1521
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:185836343"
variation 1596
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="c"
/replace="t"
/db_xref="dbSNP:190162062"
variation 1597
/gene="CDK1"
/gene_synonym="CDC2; CDC28A; P34CDC2"
/replace="g"
/replace="t"
/db_xref="dbSNP:3213053"
ORIGIN
agcgcggtgagtttgaaactgctcgcacttggcttcaaagctggctcttggaaattgagcggagagcgacgcggttgttgtagctgccgctgcggccgccgcggaataataagccgggatctaccatacccattgactaactatggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataagggtagacacaaaactacaggtcaagtggtagccatgaaaaaaatcagactagaaagtgaagaggaaggggttcctagtactgcaattcgggaaatttctctattaaaggaacttcgtcatccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatctttgagtttctttccatggatctgaagaaatacttggattctatccctcctggtcagtacatggattcttcacttgttaaggtaaaagcttaactaattttattaatatttatgcactgtggatataaagggactatatatagaagtccctgcattttgtgggaatatgcttggaaaaagtgttagaataagaaaaagtatttcatttttctccctcatggttagtttatacaggttagagatacccatgttattaccagatagtgtttctagtaagtaaaaattagtgcctgagataacatagaactggtaggtattgttggaagctagggtagtctggtctttctttggctgtcagatacatgtaaaacaaagtaatgaaagcctagggcagagtggtggttgtaggtgttttattccagttttgaacatgttttggtcaatttattgtagacatttattatatttcaggtaaattataaaattgtatagttttaagtactgaagtatataaaagtgtcttattcttgcaccagttctaccaaaccactctgcagaggtagcgctgttagttttatttgtaatcttacacttgtatgtatgttcactttgtatgtatataaagatttttttttttacacaaggtggacttatttgcatatgtatatatacatattttcccttttttgtgtaaaacattatcaagacgtagatctacctatgtctatttacatttttgatataattaaaccacttccatattgatgaacatttaaattattttccaacttggttattgttgctcttattaacagtactgcactgaatgtccttatagatatttatcttcgtatgcaactttataggataaatttttagaatgggaatgatggattgaagatgtttatttacattttgatagatattgccggttgccccctaaaaaacttgtagcaatttactcttaaatactcatggtgtgtaatacttattgttttagtacatcattgccaaaacttggttttatcaatctgttaactatgtgaaaaaggcatattaagattgttttaattttatatttcatgacaatttaacacttcatatttagctattataaaccgcctatattttcgttaggatacgttctttaacaatcttgcatgacttttggactttctgcttttatgtcttgcttaagtcttcctcactcaaagatcgaatgtattagaataatacatgtcagtatttttctggtagttttagtaagtcctgtcttccacacatactttttttgtcttaaattctgtattaagatttattttgacttaaaaactgggatacagattctgctttatctttttcc
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:983 -> Molecular function: GO:0004672 [protein kinase activity] evidence: NAS
GeneID:983 -> Molecular function: GO:0004693 [cyclin-dependent protein serine/threonine kinase activity] evidence: IDA
GeneID:983 -> Molecular function: GO:0004693 [cyclin-dependent protein serine/threonine kinase activity] evidence: TAS
GeneID:983 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:983 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:983 -> Molecular function: GO:0008353 [RNA polymerase II carboxy-terminal domain kinase activity] evidence: IDA
GeneID:983 -> Molecular function: GO:0030332 [cyclin binding] evidence: IEA
GeneID:983 -> Molecular function: GO:0030544 [Hsp70 protein binding] evidence: IEA
GeneID:983 -> Molecular function: GO:0035173 [histone kinase activity] evidence: IEA
GeneID:983 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:983 -> Biological process: GO:0000083 [regulation of transcription involved in G1/S phase of mitotic cell cycle] evidence: TAS
GeneID:983 -> Biological process: GO:0000086 [G2/M transition of mitotic cell cycle] evidence: TAS
GeneID:983 -> Biological process: GO:0000165 [MAPK cascade] evidence: TAS
GeneID:983 -> Biological process: GO:0000186 [activation of MAPKK activity] evidence: TAS
GeneID:983 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS
GeneID:983 -> Biological process: GO:0000226 [microtubule cytoskeleton organization] evidence: TAS
GeneID:983 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:983 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0006260 [DNA replication] evidence: TAS
GeneID:983 -> Biological process: GO:0006281 [DNA repair] evidence: TAS
GeneID:983 -> Biological process: GO:0006461 [protein complex assembly] evidence: IEA
GeneID:983 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:983 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:983 -> Biological process: GO:0007077 [mitotic nuclear envelope disassembly] evidence: TAS
GeneID:983 -> Biological process: GO:0007095 [mitotic G2 DNA damage checkpoint] evidence: IEA
GeneID:983 -> Biological process: GO:0007098 [centrosome cycle] evidence: TAS
GeneID:983 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS
GeneID:983 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: TAS
GeneID:983 -> Biological process: GO:0007344 [pronuclear fusion] evidence: TAS
GeneID:983 -> Biological process: GO:0007411 [axon guidance] evidence: TAS
GeneID:983 -> Biological process: GO:0007569 [cell aging] evidence: IEA
GeneID:983 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0009636 [response to toxic substance] evidence: IEA
GeneID:983 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IEA
GeneID:983 -> Biological process: GO:0014038 [regulation of Schwann cell differentiation] evidence: TAS
GeneID:983 -> Biological process: GO:0014070 [response to organic cyclic compound] evidence: IEA
GeneID:983 -> Biological process: GO:0014075 [response to amine stimulus] evidence: IEA
GeneID:983 -> Biological process: GO:0014823 [response to activity] evidence: IEA
GeneID:983 -> Biological process: GO:0016477 [cell migration] evidence: TAS
GeneID:983 -> Biological process: GO:0030261 [chromosome condensation] evidence: IEA
GeneID:983 -> Biological process: GO:0031100 [organ regeneration] evidence: IEA
GeneID:983 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:983 -> Biological process: GO:0033160 [positive regulation of protein import into nucleus, translocation] evidence: IEA
GeneID:983 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0034501 [protein localization to kinetochore] evidence: IDA
GeneID:983 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:983 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
GeneID:983 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:983 -> Biological process: GO:0045471 [response to ethanol] evidence: IEA
GeneID:983 -> Biological process: GO:0045740 [positive regulation of DNA replication] evidence: IEA
GeneID:983 -> Biological process: GO:0045931 [positive regulation of mitotic cell cycle] evidence: IEA
GeneID:983 -> Biological process: GO:0045995 [regulation of embryonic development] evidence: TAS
GeneID:983 -> Biological process: GO:0046686 [response to cadmium ion] evidence: IEA
GeneID:983 -> Biological process: GO:0046688 [response to copper ion] evidence: IEA
GeneID:983 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:983 -> Biological process: GO:0048678 [response to axon injury] evidence: IEA
GeneID:983 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:983 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS
GeneID:983 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:983 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:983 -> Biological process: GO:0055015 [ventricular cardiac muscle cell development] evidence: IEA
GeneID:983 -> Biological process: GO:0060045 [positive regulation of cardiac muscle cell proliferation] evidence: IEA
GeneID:983 -> Biological process: GO:0070301 [cellular response to hydrogen peroxide] evidence: IEA
GeneID:983 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:983 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:983 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:983 -> Cellular component: GO:0005739 [mitochondrion] evidence: TAS
GeneID:983 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA
GeneID:983 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:983 -> Cellular component: GO:0005876 [spindle microtubule] evidence: IDA
GeneID:983 -> Cellular component: GO:0030496 [midbody] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001163878 -> EC 2.7.11.22
NP_001163878 -> EC 2.7.11.23
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.