2024-04-26 14:35:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001170406 1754 bp mRNA linear PRI 15-JUL-2013 DEFINITION Homo sapiens cyclin-dependent kinase 1 (CDK1), transcript variant 4, mRNA. ACCESSION NM_001170406 VERSION NM_001170406.1 GI:281427277 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1754) AUTHORS Kabuta,T., Mitsui,T., Takahashi,M., Fujiwara,Y., Kabuta,C., Konya,C., Tsuchiya,Y., Hatanaka,Y., Uchida,K., Hohjoh,H. and Wada,K. TITLE Ubiquitin C-terminal hydrolase L1 (UCH-L1) acts as a novel potentiator of cyclin-dependent kinases to enhance cell proliferation independently of its hydrolase activity JOURNAL J. Biol. Chem. 288 (18), 12615-12626 (2013) PUBMED 23543736 REMARK GeneRIF: UCH-L1 physically interacts with CDK1, CDK4, and CDK5, enhancing their kinase activity. REFERENCE 2 (bases 1 to 1754) AUTHORS Schofield,A.V., Gamell,C., Suryadinata,R., Sarcevic,B. and Bernard,O. TITLE Tubulin polymerization promoting protein 1 (Tppp1) phosphorylation by Rho-associated coiled-coil kinase (rock) and cyclin-dependent kinase 1 (Cdk1) inhibits microtubule dynamics to increase cell proliferation JOURNAL J. Biol. Chem. 288 (11), 7907-7917 (2013) PUBMED 23355470 REMARK GeneRIF: dual Rock and Cdk phosphorylation of Tppp1 inhibits its regulation of the cell cycle to increase cell proliferation REFERENCE 3 (bases 1 to 1754) AUTHORS Cho,H.J., Oh,Y.J., Han,S.H., Chung,H.J., Kim,C.H., Lee,N.S., Kim,W.J., Choi,J.M. and Kim,H. TITLE Cdk1 protein-mediated phosphorylation of receptor-associated protein 80 (RAP80) serine 677 modulates DNA damage-induced G2/M checkpoint and cell survival JOURNAL J. Biol. Chem. 288 (6), 3768-3776 (2013) PUBMED 23264621 REMARK GeneRIF: post-translational phosphorylation of RAP80 by the Cdk1-cyclin B(1) complex is important for RAP80 functional sensitivity to IR and G(2)/M checkpoint control. REFERENCE 4 (bases 1 to 1754) AUTHORS Zhao,X.F., Zhao,M.Y., Chai,L., Kukuruga,D., Tan,M. and Stass,S.A. TITLE Amplified RPS6KB1 and CDC2 genes are potential biomarkers for aggressive HIV+/EBV+ diffuse large B-cell lymphomas JOURNAL Int J Clin Exp Pathol 6 (2), 148-154 (2013) PUBMED 23330000 REMARK GeneRIF: HIV+/EBV+ aggressive diffuse large B-cell lymphoma could be potentially treated by targeting RPS6KB1 and CDC2 genes. REFERENCE 5 (bases 1 to 1754) AUTHORS Parker,L.L. and Piwnica-Worms,H. TITLE Inactivation of the p34cdc2-cyclin B complex by the human WEE1 tyrosine kinase JOURNAL Science 257 (5078), 1955-1957 (1992) PUBMED 1384126 REFERENCE 6 (bases 1 to 1754) AUTHORS Koff,A., Giordano,A., Desai,D., Yamashita,K., Harper,J.W., Elledge,S., Nishimoto,T., Morgan,D.O., Franza,B.R. and Roberts,J.M. TITLE Formation and activation of a cyclin E-cdk2 complex during the G1 phase of the human cell cycle JOURNAL Science 257 (5077), 1689-1694 (1992) PUBMED 1388288 REFERENCE 7 (bases 1 to 1754) AUTHORS Dutta,A. and Stillman,B. TITLE cdc2 family kinases phosphorylate a human cell DNA replication factor, RPA, and activate DNA replication JOURNAL EMBO J. 11 (6), 2189-2199 (1992) PUBMED 1318195 REFERENCE 8 (bases 1 to 1754) AUTHORS Azzi,L., Meijer,L., Reed,S.I., Pidikiti,R. and Tung,H.Y. TITLE Interaction between the cell-cycle-control proteins p34cdc2 and p9CKShs2. Evidence for two cooperative binding domains in p9CKShs2 JOURNAL Eur. J. Biochem. 203 (3), 353-360 (1992) PUBMED 1310466 REFERENCE 9 (bases 1 to 1754) AUTHORS Nazarenko,S.A., Ostroverhova,N.V. and Spurr,N.K. TITLE Regional assignment of the human cell cycle control gene CDC2 to chromosome 10q21 by in situ hybridization JOURNAL Hum. Genet. 87 (5), 621-622 (1991) PUBMED 1916766 REFERENCE 10 (bases 1 to 1754) AUTHORS Lee,M.G. and Nurse,P. TITLE Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2 JOURNAL Nature 327 (6117), 31-35 (1987) PUBMED 3553962 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA823877.1, AK295741.1, AA459484.1 and AC022390.9. Summary: The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]. Transcript Variant: This variant (4) differs in the 5' UTR, 3' coding region and 3' UTR, compared to variant 1. The resulting isoform (4) has a distinct C-terminus and is shorter than isoform 1. Both variants 4 and 5 encode the same isoform (4). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK295741.1, DC334373.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025083 [ECO:0000350] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-34 DA823877.1 2-35 35-703 AK295741.1 1-669 704-1040 AA459484.1 103-439 c 1041-1240 AK295741.1 1007-1206 1241-1241 AC022390.9 119557-119557 1242-1754 AK295741.1 1208-1720 FEATURES Location/Qualifiers source 1..1754 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="10" /map="10q21.1" gene 1..1754 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /note="cyclin-dependent kinase 1" /db_xref="GeneID:983" /db_xref="HGNC:1722" /db_xref="MIM:116940" exon 1..129 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /inference="alignment:Splign:1.39.8" variation 52 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:115762205" exon 130..191 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /inference="alignment:Splign:1.39.8" misc_feature 146..148 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /note="upstream in-frame stop codon" variation 146 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="g" /replace="t" /db_xref="dbSNP:3213028" CDS 155..484 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /EC_number="2.7.11.23" /EC_number="2.7.11.22" /note="isoform 4 is encoded by transcript variant 4; cell division cycle 2, G1 to S and G2 to M; cell division control protein 2 homolog; p34 protein kinase; cell cycle controller CDC2; cell division protein kinase 1" /codon_start=1 /product="cyclin-dependent kinase 1 isoform 4" /protein_id="NP_001163877.1" /db_xref="GI:281427278" /db_xref="GeneID:983" /db_xref="HGNC:1722" /db_xref="MIM:116940" /translation="
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKVKA
" misc_feature 155..157 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="N-acetylmethionine; propagated from UniProtKB/Swiss-Prot (P06493.3); acetylation site" misc_feature 161..>472 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /note="Protein Kinases, catalytic domain; Region: PKc_like; cl09925" /db_xref="CDD:214163" misc_feature 164..166 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine, by PKR; propagated from UniProtKB/Swiss-Prot (P06493.3); phosphorylation site" misc_feature 170..172 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P06493.3); acetylation site" misc_feature order(182..196,206..208,245..247,251..253,344..346, 392..403,410..412,416..418) /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /note="active site" /db_xref="CDD:173623" misc_feature order(182..196,206..208,245..247,251..253,344..346, 392..403,410..412) /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:173623" misc_feature 194..196 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by PKMYT1; propagated from UniProtKB/Swiss-Prot (P06493.3); phosphorylation site" misc_feature 197..199 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine, by PKMYT1, WEE1, WEE2 and PKC/PRKCD; propagated from UniProtKB/Swiss-Prot (P06493.3); phosphorylation site" misc_feature 209..211 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine; propagated from UniProtKB/Swiss-Prot (P06493.3); phosphorylation site" misc_feature 269..271 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P06493.3); phosphorylation site" misc_feature 383..385 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine; propagated from UniProtKB/Swiss-Prot (P06493.3); phosphorylation site" variation 189..190 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="" /replace="a" /db_xref="dbSNP:67885060" exon 192..348 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /inference="alignment:Splign:1.39.8" variation 222 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:111992007" variation 237 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:377117179" variation 299 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:142650572" variation 329 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:8755" exon 349..1754 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /inference="alignment:Splign:1.39.8" STS 360..554 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /standard_name="SHGC-64950" /db_xref="UniSTS:72564" variation 368 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:11540347" variation 382 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:148632129" variation 424 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:144445383" variation 425 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:147689519" variation 451 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:373485880" variation 452 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:374332309" variation 507 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:142079607" variation 682 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:12415622" variation 704 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:2261327" variation 748 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:3213049" variation 753 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:3213050" variation 764 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="c" /db_xref="dbSNP:140037449" variation 829 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:373026408" variation 839 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="g" /replace="t" /db_xref="dbSNP:149852034" variation 1016 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="g" /replace="t" /db_xref="dbSNP:12220787" variation 1040 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:3213051" variation 1100 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:147945484" variation 1196 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:3213052" variation 1208 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:373908539" variation 1241 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:2456774" variation 1321 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:181575957" variation 1375 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:113978841" variation 1421 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="a" /replace="g" /db_xref="dbSNP:141764318" variation 1443 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="g" /db_xref="dbSNP:369360059" variation 1472 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:116168241" variation 1533 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:185836343" variation 1608 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="c" /replace="t" /db_xref="dbSNP:190162062" variation 1609 /gene="CDK1" /gene_synonym="CDC2; CDC28A; P34CDC2" /replace="g" /replace="t" /db_xref="dbSNP:3213053" ORIGIN
agccgccctttcctctttctttcgcgctctagccacccgggaaggcctgcccagcgtagctgggctctgattggctgctttgaaagtctacgggctacccgattggtgaatccggggccctttagcgcggatctaccatacccattgactaactatggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataagggtagacacaaaactacaggtcaagtggtagccatgaaaaaaatcagactagaaagtgaagaggaaggggttcctagtactgcaattcgggaaatttctctattaaaggaacttcgtcatccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatctttgagtttctttccatggatctgaagaaatacttggattctatccctcctggtcagtacatggattcttcacttgttaaggtaaaagcttaactaattttattaatatttatgcactgtggatataaagggactatatatagaagtccctgcattttgtgggaatatgcttggaaaaagtgttagaataagaaaaagtatttcatttttctccctcatggttagtttatacaggttagagatacccatgttattaccagatagtgtttctagtaagtaaaaattagtgcctgagataacatagaactggtaggtattgttggaagctagggtagtctggtctttctttggctgtcagatacatgtaaaacaaagtaatgaaagcctagggcagagtggtggttgtaggtgttttattccagttttgaacatgttttggtcaatttattgtagacatttattatatttcaggtaaattataaaattgtatagttttaagtactgaagtatataaaagtgtcttattcttgcaccagttctaccaaaccactctgcagaggtagcgctgttagttttatttgtaatcttacacttgtatgtatgttcactttgtatgtatataaagatttttttttttacacaaggtggacttatttgcatatgtatatatacatattttcccttttttgtgtaaaacattatcaagacgtagatctacctatgtctatttacatttttgatataattaaaccacttccatattgatgaacatttaaattattttccaacttggttattgttgctcttattaacagtactgcactgaatgtccttatagatatttatcttcgtatgcaactttataggataaatttttagaatgggaatgatggattgaagatgtttatttacattttgatagatattgccggttgccccctaaaaaacttgtagcaatttactcttaaatactcatggtgtgtaatacttattgttttagtacatcattgccaaaacttggttttatcaatctgttaactatgtgaaaaaggcatattaagattgttttaattttatatttcatgacaatttaacacttcatatttagctattataaaccgcctatattttcgttaggatacgttctttaacaatcttgcatgacttttggactttctgcttttatgtcttgcttaagtcttcctcactcaaagatcgaatgtattagaataatacatgtcagtatttttctggtagttttagtaagtcctgtcttccacacatactttttttgtcttaaattctgtattaagatttattttgacttaaaaactgggatacagattctgctttatctttttcc
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:983 -> Molecular function: GO:0004672 [protein kinase activity] evidence: NAS GeneID:983 -> Molecular function: GO:0004693 [cyclin-dependent protein serine/threonine kinase activity] evidence: IDA GeneID:983 -> Molecular function: GO:0004693 [cyclin-dependent protein serine/threonine kinase activity] evidence: TAS GeneID:983 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:983 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA GeneID:983 -> Molecular function: GO:0008353 [RNA polymerase II carboxy-terminal domain kinase activity] evidence: IDA GeneID:983 -> Molecular function: GO:0030332 [cyclin binding] evidence: IEA GeneID:983 -> Molecular function: GO:0030544 [Hsp70 protein binding] evidence: IEA GeneID:983 -> Molecular function: GO:0035173 [histone kinase activity] evidence: IEA GeneID:983 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS GeneID:983 -> Biological process: GO:0000083 [regulation of transcription involved in G1/S phase of mitotic cell cycle] evidence: TAS GeneID:983 -> Biological process: GO:0000086 [G2/M transition of mitotic cell cycle] evidence: TAS GeneID:983 -> Biological process: GO:0000165 [MAPK cascade] evidence: TAS GeneID:983 -> Biological process: GO:0000186 [activation of MAPKK activity] evidence: TAS GeneID:983 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS GeneID:983 -> Biological process: GO:0000226 [microtubule cytoskeleton organization] evidence: TAS GeneID:983 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS GeneID:983 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0006260 [DNA replication] evidence: TAS GeneID:983 -> Biological process: GO:0006281 [DNA repair] evidence: TAS GeneID:983 -> Biological process: GO:0006461 [protein complex assembly] evidence: IEA GeneID:983 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:983 -> Biological process: GO:0007067 [mitosis] evidence: IEA GeneID:983 -> Biological process: GO:0007077 [mitotic nuclear envelope disassembly] evidence: TAS GeneID:983 -> Biological process: GO:0007095 [mitotic G2 DNA damage checkpoint] evidence: IEA GeneID:983 -> Biological process: GO:0007098 [centrosome cycle] evidence: TAS GeneID:983 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS GeneID:983 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: TAS GeneID:983 -> Biological process: GO:0007344 [pronuclear fusion] evidence: TAS GeneID:983 -> Biological process: GO:0007411 [axon guidance] evidence: TAS GeneID:983 -> Biological process: GO:0007569 [cell aging] evidence: IEA GeneID:983 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0009636 [response to toxic substance] evidence: IEA GeneID:983 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IEA GeneID:983 -> Biological process: GO:0014038 [regulation of Schwann cell differentiation] evidence: TAS GeneID:983 -> Biological process: GO:0014070 [response to organic cyclic compound] evidence: IEA GeneID:983 -> Biological process: GO:0014075 [response to amine stimulus] evidence: IEA GeneID:983 -> Biological process: GO:0014823 [response to activity] evidence: IEA GeneID:983 -> Biological process: GO:0016477 [cell migration] evidence: TAS GeneID:983 -> Biological process: GO:0030261 [chromosome condensation] evidence: IEA GeneID:983 -> Biological process: GO:0031100 [organ regeneration] evidence: IEA GeneID:983 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS GeneID:983 -> Biological process: GO:0033160 [positive regulation of protein import into nucleus, translocation] evidence: IEA GeneID:983 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0034501 [protein localization to kinetochore] evidence: IDA GeneID:983 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0042493 [response to drug] evidence: IEA GeneID:983 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA GeneID:983 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:983 -> Biological process: GO:0045471 [response to ethanol] evidence: IEA GeneID:983 -> Biological process: GO:0045740 [positive regulation of DNA replication] evidence: IEA GeneID:983 -> Biological process: GO:0045931 [positive regulation of mitotic cell cycle] evidence: IEA GeneID:983 -> Biological process: GO:0045995 [regulation of embryonic development] evidence: TAS GeneID:983 -> Biological process: GO:0046686 [response to cadmium ion] evidence: IEA GeneID:983 -> Biological process: GO:0046688 [response to copper ion] evidence: IEA GeneID:983 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:983 -> Biological process: GO:0048678 [response to axon injury] evidence: IEA GeneID:983 -> Biological process: GO:0051301 [cell division] evidence: IEA GeneID:983 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS GeneID:983 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:983 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:983 -> Biological process: GO:0055015 [ventricular cardiac muscle cell development] evidence: IEA GeneID:983 -> Biological process: GO:0060045 [positive regulation of cardiac muscle cell proliferation] evidence: IEA GeneID:983 -> Biological process: GO:0070301 [cellular response to hydrogen peroxide] evidence: IEA GeneID:983 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:983 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:983 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:983 -> Cellular component: GO:0005739 [mitochondrion] evidence: TAS GeneID:983 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA GeneID:983 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:983 -> Cellular component: GO:0005876 [spindle microtubule] evidence: IDA GeneID:983 -> Cellular component: GO:0030496 [midbody] evidence: IDA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_001163877 -> EC 2.7.11.22 NP_001163877 -> EC 2.7.11.23
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.