2025-07-06 04:21:05, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001168401 842 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens brain expressed X-linked 2 (BEX2), transcript variant 4, mRNA. ACCESSION NM_001168401 VERSION NM_001168401.1 GI:270309186 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 842) AUTHORS Zhou,X., Meng,Q., Xu,X., Zhi,T., Shi,Q., Wang,Y. and Yu,R. TITLE Bex2 regulates cell proliferation and apoptosis in malignant glioma cells via the c-Jun NH2-terminal kinase pathway JOURNAL Biochem. Biophys. Res. Commun. 427 (3), 574-580 (2012) PUBMED 23022184 REMARK GeneRIF: Bex2 may be an important player during the development of glioma REFERENCE 2 (bases 1 to 842) AUTHORS Han,Q.Y., Fan,Y.H., Wang,Y.L., Zhang,S.D. and Han,C.Y. TITLE [BEX2 regulates cell cycle through the interaction with INI1/hSNF5] JOURNAL Yi Chuan 34 (6), 711-718 (2012) PUBMED 22698742 REMARK GeneRIF: Both BEX2 and INI1/hSNF5 mainly localized in cell nucleus. REFERENCE 3 (bases 1 to 842) AUTHORS Naderi,A., Liu,J. and Francis,G.D. TITLE A feedback loop between BEX2 and ErbB2 mediated by c-Jun signaling in breast cancer JOURNAL Int. J. Cancer 130 (1), 71-82 (2012) PUBMED 21384344 REMARK GeneRIF: BEX2 overexpression was associated with breast cancer. REFERENCE 4 (bases 1 to 842) AUTHORS Naderi,A., Liu,J. and Hughes-Davies,L. TITLE BEX2 has a functional interplay with c-Jun/JNK and p65/RelA in breast cancer JOURNAL Mol. Cancer 9, 111 (2010) PUBMED 20482821 REMARK GeneRIF: BEX2 has a functional interplay with c-Jun and p65/RelA in breast cancer. Publication Status: Online-Only REFERENCE 5 (bases 1 to 842) AUTHORS Rohrs,S., Dirks,W.G., Meyer,C., Marschalek,R., Scherr,M., Slany,R., Wallace,A., Drexler,H.G. and Quentmeier,H. TITLE Hypomethylation and expression of BEX2, IGSF4 and TIMP3 indicative of MLL translocations in acute myeloid leukemia JOURNAL Mol. Cancer 8, 86 (2009) PUBMED 19835597 REMARK GeneRIF: These results suggest that the conspicuous expression of the tumor suppressor genes BEX2, IGSF4 and TIMP3 in MLLmu acute myeloid leukemias cell lines is the consequence of altered epigenetic properties of MLL fusion proteins. Publication Status: Online-Only REFERENCE 6 (bases 1 to 842) AUTHORS Fischer,C., Drexler,H.G., Reinhardt,J., Zaborski,M. and Quentmeier,H. TITLE Epigenetic regulation of brain expressed X-linked-2, a marker for acute myeloid leukemia with mixed lineage leukemia rearrangements JOURNAL Leukemia 21 (2), 374-377 (2007) PUBMED 17251904 REMARK GeneRIF: Correlation between BEX2 expression and mixed lineage leukemia chromosomal aberrations are shown in the cell lines. REFERENCE 7 (bases 1 to 842) AUTHORS Foltz,G., Ryu,G.Y., Yoon,J.G., Nelson,T., Fahey,J., Frakes,A., Lee,H., Field,L., Zander,K., Sibenaller,Z., Ryken,T.C., Vibhakar,R., Hood,L. and Madan,A. TITLE Genome-wide analysis of epigenetic silencing identifies BEX1 and BEX2 as candidate tumor suppressor genes in malignant glioma JOURNAL Cancer Res. 66 (13), 6665-6674 (2006) PUBMED 16818640 REMARK GeneRIF: Two novel brain expressed genes, BEX1 and BEX2 are identified; they are silenced in all glioma specimens and exhibit extensive promoter hypermethylation. REFERENCE 8 (bases 1 to 842) AUTHORS Han,C., Liu,H., Liu,J., Yin,K., Xie,Y., Shen,X., Wang,Y., Yuan,J., Qiang,B., Liu,Y.J. and Peng,X. TITLE Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex JOURNAL Nucleic Acids Res. 33 (20), 6555-6565 (2005) PUBMED 16314316 REMARK GeneRIF: hBex2 may act as a specific regulator during embryonic development by modulating the transcriptional activity of a novel E-box sequence-binding complex that contains hBex2, LMO2, NSCL2 and LDB1. Publication Status: Online-Only REFERENCE 9 (bases 1 to 842) AUTHORS Alvarez,E., Zhou,W., Witta,S.E. and Freed,C.R. TITLE Characterization of the Bex gene family in humans, mice, and rats JOURNAL Gene 357 (1), 18-28 (2005) PUBMED 15958283 REFERENCE 10 (bases 1 to 842) AUTHORS Baldisseri,D.M., Margolis,J.W., Weber,D.J., Koo,J.H. and Margolis,F.L. TITLE Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction JOURNAL J. Mol. Biol. 319 (3), 823-837 (2002) PUBMED 12054873 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK001963.1, BU596902.1 and BC015522.1. Summary: This gene belongs to the brain expressed X-linked gene family. The encoded protein interacts with the transcription factor LIM domain only 2 in a DNA-binding complex that recognizes the E-box element and promotes transcription. This gene has been found to be a tumor suppressor that is silenced in human glioma. In breast cancer cells, this gene product modulates apoptosis in response to estrogen and tamoxifen, and enhances the anti-proliferative effect of tamoxifen. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]. Transcript Variant: This variant (4) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream start codon, compared to variant 1. The encoded isoform (3) has a shorter N-terminus, compared to isoform 1. Variants 3 and 4 encode the same isoform (3). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CK001963.1, BU596902.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-32 CK001963.1 4-35 33-517 BU596902.1 16-500 518-842 BC015522.1 468-792 FEATURES Location/Qualifiers source 1..842 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" /map="Xq22" gene 1..842 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /note="brain expressed X-linked 2" /db_xref="GeneID:84707" /db_xref="HGNC:30933" /db_xref="MIM:300691" exon 1..115 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /inference="alignment:Splign:1.39.8" variation 89 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="a" /replace="c" /db_xref="dbSNP:11545116" variation 97 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="c" /replace="g" /db_xref="dbSNP:11545114" misc_feature 98..100 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /note="upstream in-frame stop codon" exon 116..191 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /inference="alignment:Splign:1.39.8" variation 134 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="c" /replace="t" /db_xref="dbSNP:3184865" variation 135 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="c" /replace="g" /db_xref="dbSNP:1128200" variation 141 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="a" /replace="g" /db_xref="dbSNP:1045050" variation 150 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="a" /replace="g" /db_xref="dbSNP:1045052" variation 151 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="c" /replace="t" /db_xref="dbSNP:1045055" variation 153 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="g" /replace="t" /db_xref="dbSNP:1045057" variation 176 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="a" /replace="g" /db_xref="dbSNP:1128202" exon 192..827 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /inference="alignment:Splign:1.39.8" CDS 197..583 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /note="isoform 3 is encoded by transcript variant 4; protein BEX2; hBex2; brain-expressed X-linked protein 2" /codon_start=1 /product="protein BEX2 isoform 3" /protein_id="NP_001161873.1" /db_xref="GI:270309187" /db_xref="CCDS:CCDS14505.1" /db_xref="GeneID:84707" /db_xref="HGNC:30933" /db_xref="MIM:300691" /translation="
MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP
" misc_feature 236..577 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /note="Brain expressed X-linked like family; Region: BEX; pfam04538" /db_xref="CDD:191022" variation 518 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="c" /replace="t" /db_xref="dbSNP:7557" variation 579 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="a" /replace="c" /db_xref="dbSNP:11545113" variation 620 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="c" /replace="g" /db_xref="dbSNP:11545115" STS 668..793 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /standard_name="WI-15922" /db_xref="UniSTS:62839" variation 709 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" /replace="c" /replace="t" /db_xref="dbSNP:1045299" polyA_signal 806..811 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" polyA_site 827 /gene="BEX2" /gene_synonym="BEX1; DJ79P11.1" ORIGIN
acacgtgatcggccaacactgagtcttacctcgttgtggcgtcagaaccgccgtcgctcgctcccttctcggcagtggtacctgttcccggtgtccctgaggacgtgcgggccaggtttgcggggccaagtgttgcggcgacgcacctcacgtcgagaatcgggaggaggagactgcaaggataggcccaggagtaatggagtccaaagaggaacgagcgttaaacaatctcatcgtggaaaatgtcaaccaggaaaatgatgaaaaagatgaaaaggagcaagttgctaataaaggggagcccttggccctacctttgaatgttagtgaatactgtgtgcctagaggaaaccgtaggcggttccgcgttaggcagcccatcctgcagtatagatgggacataatgcataggcttggagagccacaggcaaggatgagagaggagaatatggaaaggattggggaggaggtgagacagctgatggaaaagctgagggaaaagcagttgagtcatagtttgcgggcagtcagcactgatccccctcaccatgaccatcacgatgagttttgccttatgccctgaatcctgatggtttccctgaagttaatagggagacccctgcttcctaaacttacacatttgtggtgtacctttgtcgtaaacgttttgatgttacctatttcttgtgggtctcctattaccagcttctaaatgaatgttgtttttgacccagtttgtaagtttctgtcagcaggagagttttacctattgcatggaaagatgctcattatatattgtgaagttaataaaacagttttaaaaagcaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:84707 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:84707 -> Biological process: GO:0007049 [cell cycle] evidence: IEA GeneID:84707 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IDA GeneID:84707 -> Biological process: GO:0051726 [regulation of cell cycle] evidence: IDA GeneID:84707 -> Cellular component: GO:0005634 [nucleus] evidence: IEA GeneID:84707 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.