GGRNA Home | Help | Advanced search

2019-03-25 14:42:50, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001166698            3477 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens family with sequence similarity 13, member C (FAM13C),
            transcript variant 4, mRNA.
ACCESSION   NM_001166698
VERSION     NM_001166698.1  GI:262359941
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3477)
  AUTHORS   Wu,J.H., Lemaitre,R.N., Manichaikul,A., Guan,W., Tanaka,T., Foy,M.,
            Kabagambe,E.K., Djousse,L., Siscovick,D., Fretts,A.M., Johnson,C.,
            King,I.B., Psaty,B.M., McKnight,B., Rich,S.S., Chen,Y.D.,
            Nettleton,J.A., Tang,W., Bandinelli,S., Jacobs,D.R. Jr.,
            Browning,B.L., Laurie,C.C., Gu,X., Tsai,M.Y., Steffen,L.M.,
            Ferrucci,L., Fornage,M. and Mozaffarian,D.
  TITLE     Genome-wide association study identifies novel loci associated with
            concentrations of four plasma phospholipid fatty acids in the de
            novo lipogenesis pathway: results from the Cohorts for Heart and
            Aging Research in Genomic Epidemiology (CHARGE) consortium
  JOURNAL   Circ Cardiovasc Genet 6 (2), 171-183 (2013)
   PUBMED   23362303
REFERENCE   2  (bases 1 to 3477)
  AUTHORS   Karasik,D., Hsu,Y.H., Zhou,Y., Cupples,L.A., Kiel,D.P. and
            Demissie,S.
  TITLE     Genome-wide pleiotropy of osteoporosis-related phenotypes: the
            Framingham Study
  JOURNAL   J. Bone Miner. Res. 25 (7), 1555-1563 (2010)
   PUBMED   20200953
  REMARK    GeneRIF: Observational study and genome-wide association study of
            gene-disease association. (HuGE Navigator)
REFERENCE   3  (bases 1 to 3477)
  AUTHORS   Grupe,A., Li,Y., Rowland,C., Nowotny,P., Hinrichs,A.L., Smemo,S.,
            Kauwe,J.S., Maxwell,T.J., Cherny,S., Doil,L., Tacey,K., van
            Luchene,R., Myers,A., Wavrant-De Vrieze,F., Kaleem,M.,
            Hollingworth,P., Jehu,L., Foy,C., Archer,N., Hamilton,G.,
            Holmans,P., Morris,C.M., Catanese,J., Sninsky,J., White,T.J.,
            Powell,J., Hardy,J., O'Donovan,M., Lovestone,S., Jones,L.,
            Morris,J.C., Thal,L., Owen,M., Williams,J. and Goate,A.
  TITLE     A scan of chromosome 10 identifies a novel locus showing strong
            association with late-onset Alzheimer disease
  JOURNAL   Am. J. Hum. Genet. 78 (1), 78-88 (2006)
   PUBMED   16385451
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DA188937.1, AK316542.1, BM714192.1, BP394664.1 and BM677909.1.
            
            Transcript Variant: This variant (4) differs in its 5' UTR, uses a
            downstream start codon, and uses an alternate in-frame splice site
            in the central coding region, compared to variant 1. The encoded
            isoform (4) has a shorter N-terminus, compared to isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK316542.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025082 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-4                 DA188937.1         1-4
            5-2281              AK316542.1         1-2277
            2282-2645           BM714192.1         1-364               c
            2646-3453           AK316542.1         2642-3449
            3454-3456           BP394664.1         491-493
            3457-3477           BM677909.1         1-21                c
FEATURES             Location/Qualifiers
     source          1..3477
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q21.1"
     gene            1..3477
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /note="family with sequence similarity 13, member C"
                     /db_xref="GeneID:220965"
                     /db_xref="HGNC:19371"
     exon            1..196
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            197..281
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    250..252
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /note="upstream in-frame stop codon"
     exon            282..338
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            339..543
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     CDS             469..1974
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /note="isoform 4 is encoded by transcript variant 4;
                     family with sequence similarity 13, member C1; protein
                     FAM13C"
                     /codon_start=1
                     /product="protein FAM13C isoform 4"
                     /protein_id="NP_001160170.1"
                     /db_xref="GI:262359942"
                     /db_xref="CCDS:CCDS53538.1"
                     /db_xref="GeneID:220965"
                     /db_xref="HGNC:19371"
                     /translation="
MGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKDPAPASTQSVLADGTDSADPSPVHKDGQNEADSAPEDLHSVGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDGKEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEEQGSAPKGPPRNLLCEQPTVPRENGKPEAAGPEPSSSGEETPDAALTCLKERREQLPPQEDSKVTKQDKNLIKPLYDRYRIIKQILSTPSLIPTIEEEDSDEDRPQGSQQPSLADPASHLPVGDHLTYSNETEPVRALLPDEKKEVKPPALSMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFFKQTGRSPQKEDRIPMADEYYEYKHIKAKLRLLEVLISKQDVAKTI
"
     exon            544..662
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            663..726
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            727..811
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            812..1022
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            1023..1161
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            1162..1243
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            1244..1455
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            1456..1551
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            1552..1748
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            1749..1850
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     exon            1851..3460
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /inference="alignment:Splign:1.39.8"
     STS             2028..2219
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /standard_name="G65661"
                     /db_xref="UniSTS:225452"
     STS             2135..2234
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /standard_name="SHGC-30631"
                     /db_xref="UniSTS:51822"
     variation       2519
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11540126"
     STS             3282..3383
                     /gene="FAM13C"
                     /gene_synonym="FAM13C1"
                     /standard_name="D10S1860"
                     /db_xref="UniSTS:65450"
ORIGIN      
gtgcagacagcagcccaaggtagagcgagcgtgccgggcgagcccggagacttgccttgcaatgccatgtttgtgtatgtgctctaactcccggagagcaatcagggagacggctccccggccagacttggctgatgttttcttgtttctgtttcagccttcaggataattccttcagcagcaccactgtaacagagcctgagagaaggggagagaggtgtgccaaagtgtgcatctgcaggccgaagatgaggcctggacttcctgctccaggtgcacaggtgtgacgaagatccagtctctctacatgaagaccagactgattgctccagtctcagagatgaaaacaataaagagaactaccccgacgcaggggctctggtagaagagcacgcgccgccctcttgggagccgcagcagcagaatgtagaggcgaccgtgctggtggacagcgtattgcgacccagcatgggcaacttcaagtccaggaagcccaagtccatcttcaaagcggagagcgggaggagccacggagaaagtcaggagacagagcatgtggtatccagccagtcagagtgtcaggtgagagcaggaacaccagctcatgagagtccacaaaacaatgccttcaagtgccaagaaacagtgcgacttcaaccaagaatagaccagaggactgccatttcgccaaaggatgcttttgaaactcggcaggacttaaatgaggaagaagctgctcaggtgcatggagtcaaggacccggcgccagcatcaacccagagcgtgcttgccgatgggacagattctgcagacccctcaccagtccacaaagatgggcagaatgaggccgacagtgcaccagaagacctccactctgtggggaccagcaggctgctctatcacatcactgatggtgataacccactgctgtcgccacgatgctccatcttcagccaaagccagagattcaacttagaccccgagtcagccccatctccacccagcactcagcagtttatgatgccgcggagttcttcacgctgcagctgtggagatggcaaggagccacagaccatcacccagctcaccaagcacatccagagcctcaagcggaaaattcggaaatttgaagaaaaatttgaacaagaaaagaaataccggccttcacatggtgacaagacttctaatcctgaagtcctgaaatggatgaatgatttggctaaaggtcgtaaacagctcaaagaactaaagctaaagctgtcagaagaacaagggagtgctcccaaaggtccacctagaaacctgttgtgtgagcaacccacagtccccagagaaaatgggaaaccggaagctgcgggcccggagccaagctcctctggagaagagactccagatgctgccttgacatgcctgaaggagagaagagagcaacttcctccccaggaggattctaaggtaactaagcaagacaagaacctcataaagccgctttatgaccgatacagaattatcaagcaaatcttgtcaacaccttcccttattccaacaattgaggaagaggactctgatgaagaccgtccacagggaagccaacaaccttctttggcagatccagcatctcaccttcctgttggtgaccacctcacctactctaatgagactgagcctgttagggcccttttaccagatgaaaagaaagaagtaaaaccaccagctctctccatgtctaatttacatgaggctaccatgcctgtacttcttgaccatctccgagaaactagggctgacaagaagagactgcggaaagccttaagagaatttgaagaacagttttttaaacaaacaggaagaagtccacaaaaggaagataggataccaatggcagatgagtattatgaatataagcacataaaagccaaactgagactattagaggtcctcatcagcaagcaagatgtggccaaaactatttgaggttcaggaaatgttatgatcactttcacccatgatataaagtaaagtttattttcctctgccatccttgctaagtagttttgacacaatgaaaatggaagcactttagtggtagtattagctgtttttaagaaggaatagcaagtttaattatatacaaggagaagggatttaaacggggggaagaatacaacaggtagccatataattgggaaaaaattcagtgtcctccatgccaagcagaaaactcatagtcaatacaagtatttttaaaaatgtctaatattttatcaaatctaaataacatagctaggacacttgttagggaaagtttatttagtatccaaagactgtttatgttgatgtatggaaaagagcatgattttaaaaaatcaatcataggaggaaaagaaattcgcttttcaagtaggaaggaatacagctagcaagaaagcaatttatttgaaacttctaatggatttttgagtgataaaacatttactaccttgtcctttaagtctgctaggctctcagtaccctaaaataaactagattgtgttgctattttttttctttctctataaaaataacacattattttatccgttatttgaaattttacatttctggttaccaaagttcattctgatagcatgtactttgtgaattattatctttgtctataactgacagatgtttatattaaaataaaatattgtattaaaaatttaaaataggtattttggatagatatgtgtctgtagtatataatctaatgtgtccatagtattattgctaatcttttggtttactataagatgatataactattttttcattgggaatatacatttttcttaatgttccaacatctatactttgtaaagtcaaaacatttcccatgagctgtagttattcatccttctgtacaaaatgaaaagtttggaaattgtttgccctgataccttgaaaaagaagccagaatatttatttgcttcatcaacttcagtgtatatcattttgtgttattttatacgaaaacatgtttattattttcatttttgtaaaaggaagtaaaaggtcaacattttctctcatgtaccaaccttgtttgtatttctattttctgtaatgtttaagtatgatgttgaagaaattcacattctcttatagtttggatgggaagactattgactatttcagaaacagacttatttcagaggcttattgttttctctgtatttacctaatattttataacttttatgaatcagaataatgtccttcataaatttgtttaattgaagtcatctacttctaacaggacagatacacaactatttgaggtttacaaattacatctttgataagggaaatggtttcgtgacatgtacacagttgctattaaaatgtaactctatatattctatatgattgtaaatattttatacaacaatacaaataaaatatttttctattatatttaaaaaaaaaaaaaaaaaa
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.