Home |
Help |
Advanced search
2024-04-26 08:30:10, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001166170 2594 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens NIMA-related kinase 6 (NEK6), transcript variant 6,
mRNA.
ACCESSION NM_001166170
VERSION NM_001166170.1 GI:261244926
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2594)
AUTHORS Cao,X., Xia,Y., Yang,J., Jiang,J., Chen,L., Ni,R., Li,L. and Gu,Z.
TITLE Clinical and biological significance of never in mitosis gene
A-related kinase 6 (NEK6) expression in hepatic cell cancer
JOURNAL Pathol. Oncol. Res. 18 (2), 201-207 (2012)
PUBMED 21725899
REMARK GeneRIF: High Nek6 is associated with hepatic cell cancer.
REFERENCE 2 (bases 1 to 2594)
AUTHORS Bertran,M.T., Sdelci,S., Regue,L., Avruch,J., Caelles,C. and
Roig,J.
TITLE Nek9 is a Plk1-activated kinase that controls early centrosome
separation through Nek6/7 and Eg5
JOURNAL EMBO J. 30 (13), 2634-2647 (2011)
PUBMED 21642957
REMARK GeneRIF: Nek9 is a Plk1-activated kinase that controls early
centrosome separation through Nek6/7 and Eg5.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2594)
AUTHORS Jee,H.J., Kim,H.J., Kim,A.J., Song,N., Kim,M. and Yun,J.
TITLE Nek6 suppresses the premature senescence of human cancer cells
induced by camptothecin and doxorubicin treatment
JOURNAL Biochem. Biophys. Res. Commun. 408 (4), 669-673 (2011)
PUBMED 21539811
REMARK GeneRIF: These results suggest that the increased expression of
Nek6 renders cancer cells resistant to premature senescence, and
targeting Nek6 could be an efficient strategy for cancer treatment.
REFERENCE 4 (bases 1 to 2594)
AUTHORS Regue,L., Sdelci,S., Bertran,M.T., Caelles,C., Reverter,D. and
Roig,J.
TITLE DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9
JOURNAL J. Biol. Chem. 286 (20), 18118-18129 (2011)
PUBMED 21454704
REMARK GeneRIF: DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
REFERENCE 5 (bases 1 to 2594)
AUTHORS Meirelles,G.V., Silva,J.C., Mendonca Yde,A., Ramos,C.H.,
Torriani,I.L. and Kobarg,J.
TITLE Human Nek6 is a monomeric mostly globular kinase with an unfolded
short N-terminal domain
JOURNAL BMC Struct. Biol. 11, 12 (2011)
PUBMED 21320329
REMARK GeneRIF: the first low resolution 3D structure of hNek6 protein in
solution
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2594)
AUTHORS Belham,C., Comb,M.J. and Avruch,J.
TITLE Identification of the NIMA family kinases NEK6/7 as regulators of
the p70 ribosomal S6 kinase
JOURNAL Curr. Biol. 11 (15), 1155-1167 (2001)
PUBMED 11516946
REFERENCE 7 (bases 1 to 2594)
AUTHORS Kimura,M. and Okano,Y.
TITLE Identification and assignment of the human NIMA-related protein
kinase 7 gene (NEK7) to human chromosome 1q31.3
JOURNAL Cytogenet. Cell Genet. 94 (1-2), 33-38 (2001)
PUBMED 11701951
REMARK GeneRIF: Also includes phylogenetic analysis and tissue-specific
RT-PCR of human NEK6 and NEK7.
REFERENCE 8 (bases 1 to 2594)
AUTHORS Kandli,M., Feige,E., Chen,A., Kilfin,G. and Motro,B.
TITLE Isolation and characterization of two evolutionarily conserved
murine kinases (Nek6 and nek7) related to the fungal mitotic
regulator, NIMA
JOURNAL Genomics 68 (2), 187-196 (2000)
PUBMED 10964517
REFERENCE 9 (bases 1 to 2594)
AUTHORS Kobayashi,T. and Cohen,P.
TITLE Activation of serum- and glucocorticoid-regulated protein kinase by
agonists that activate phosphatidylinositide 3-kinase is mediated
by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2
JOURNAL Biochem. J. 339 (PT 2), 319-328 (1999)
PUBMED 10191262
REFERENCE 10 (bases 1 to 2594)
AUTHORS Li,M.Z., Yu,L., Liu,Q., Chu,J.Y. and Zhao,S.Y.
TITLE Assignment of NEK6, a NIMA-related gene, to human chromosome 9q33.
3-->q34.11 by radiation hybrid mapping
JOURNAL Cytogenet. Cell Genet. 87 (3-4), 271-272 (1999)
PUBMED 10702691
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AL162724.16, AL137846.24 and
BC012761.2.
Summary: The protein encoded by this gene is a kinase required for
progression through the metaphase portion of mitosis. Inhibition of
the encoded protein can lead to apoptosis. This protein also can
enhance tumorigenesis by suppressing tumor cell senescence. Several
transcript variants encoding a few different isoforms have been
found for this gene. [provided by RefSeq, Oct 2011].
Transcript Variant: This variant (6) differs in the 5' UTR, lacks a
portion of the 5' coding region, and initiates translation at a
downstream start codon, compared to variant 1. The encoded isoform
(2) is shorter than isoform 1. Variants 2, 5 and 6 encode the same
isoform (2).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
CDS exon combination :: BC012761.2, BC000101.2 [ECO:0000331]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025098 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-118 AL162724.16 88593-88710
119-237 AL162724.16 98558-98676
238-378 AL162724.16 109131-109271
379-441 AL162724.16 110545-110607
442-552 AL162724.16 118081-118191
553-661 AL137846.24 510-618
662-769 AL137846.24 1518-1625
770-864 AL137846.24 13751-13845
865-978 AL137846.24 21889-22002
979-1573 AL137846.24 25017-25611
1574-2594 BC012761.2 1572-2592
FEATURES Location/Qualifiers
source 1..2594
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/map="9q33.3-q34.11"
gene 1..2594
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="NIMA-related kinase 6"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
exon 1..118
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 23
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375658959"
variation 79
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186302284"
exon 119..237
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 129
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:373043424"
variation 134
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:79304695"
CDS 148..1089
/gene="NEK6"
/gene_synonym="SID6-1512"
/EC_number="2.7.11.1"
/note="isoform 2 is encoded by transcript variant 6;
putative serine-threonine protein kinase;
serine/threonine-protein kinase Nek6; protein kinase
SID6-1512; nimA-related protein kinase 6; never in mitosis
A-related kinase 6; NIMA (never in mitosis gene a)-related
kinase 6"
/codon_start=1
/product="serine/threonine-protein kinase Nek6 isoform 2"
/protein_id="NP_001159642.1"
/db_xref="GI:261244927"
/db_xref="CCDS:CCDS6854.1"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
/translation="
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
"
misc_feature 148..279
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9HC98.2);
Region: Interaction with ARHGAP33, ANKRA2, CDC42, PRDX3,
RAD26L, RBBP6, RPS7 and TRIP4"
misc_feature 256..258
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9HC98.2); phosphorylation site"
misc_feature 271..1068
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Catalytic domain of the Protein Serine/Threonine
Kinases, Never In Mitosis gene A-related kinase 6 and 7;
Region: STKc_Nek6_Nek7; cd08224"
/db_xref="CDD:173764"
misc_feature 280..1077
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(298..312,322..324,361..363,367..369,463..465,
511..522,532..534,538..540,661..663,667..669,673..678,
682..684,715..717,724..726,730..732,772..783)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="active site"
/db_xref="CDD:173764"
misc_feature order(298..303,307..312,322..324,361..363,367..369,
463..465,514..522,532..534,676..678,682..684,730..732)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173764"
misc_feature order(310..312,532..534,538..540,661..663,667..669,
673..675,724..726,772..783)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173764"
misc_feature 469..471
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Autoinhibitory; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); other site"
misc_feature 712..783
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173764"
misc_feature 751..753
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 763..765
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by NEK9; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 775..777
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 946..957
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9HC98.2);
Region: Interaction with APBB1"
variation 176
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:377403028"
variation 195
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:145488745"
variation 204
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:35882196"
variation 223
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140978005"
exon 238..378
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 252
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:116276253"
variation 275
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:183673274"
variation 289
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:148262318"
exon 379..441
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 396
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:141841414"
variation 408
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200803888"
variation 417
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:150614386"
variation 422
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:183711992"
exon 442..552
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 444
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:138847171"
variation 456
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:199829118"
variation 480
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186179243"
variation 488
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:370008827"
variation 496
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:143094065"
variation 498
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:115563387"
exon 553..661
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 580
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:11556892"
variation 581
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:368466543"
variation 582
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:372516510"
variation 594
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:375715210"
variation 620
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200565078"
variation 630
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201692889"
variation 643
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:369950028"
exon 662..769
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 699
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:147517890"
variation 724
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140109985"
variation 732
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144636007"
variation 734
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="g"
/replace="t"
/db_xref="dbSNP:200086787"
variation 738
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:201207004"
variation 753
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:145520134"
exon 770..864
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 831
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144397688"
variation 837
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:201833354"
variation 844
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:10760354"
variation 861
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:200895433"
exon 865..978
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 888
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:142081750"
variation 903
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:151138282"
variation 927
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191153129"
variation 957
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201681080"
variation 972
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140302963"
variation 973
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:144052872"
exon 979..2584
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 983
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200398623"
variation 998
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201113183"
variation 1018
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:146443565"
variation 1041
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375270617"
variation 1042
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200235098"
variation 1048
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:376476122"
variation 1053
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141017419"
variation 1062
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200021823"
variation 1091
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:370917966"
variation 1102
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375568776"
STS 1103..1253
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11482"
/db_xref="UniSTS:58088"
variation 1103
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201649447"
variation 1206..1207
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="c"
/db_xref="dbSNP:36107117"
variation 1292
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:138529813"
STS 1314..1574
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH12239"
/db_xref="UniSTS:63110"
variation 1428
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:187874166"
STS 1433..1582
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="SGC33089"
/db_xref="UniSTS:78220"
variation 1464
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:190024004"
variation 1465
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:142713923"
variation 1477
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:58099088"
variation 1523
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:2416"
variation 1532..1533
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="tcaa"
/db_xref="dbSNP:374990567"
variation 1591
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:146937021"
variation 1593
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:77933598"
variation 1595
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:12555646"
variation 1652
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:182662225"
variation 1664
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:147972018"
variation 1686
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186630550"
variation 1773
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191474528"
variation 1793
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185386620"
variation 1833
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141687734"
variation 1903
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:28687204"
variation 1954
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:11556890"
variation 1990
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:189086459"
STS 2062..2195
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH77983"
/db_xref="UniSTS:226"
variation 2131
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:192831011"
variation 2172
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:150524435"
variation 2181
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="t"
/db_xref="dbSNP:139595461"
variation 2186
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:76125733"
STS 2280..2517
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11599"
/db_xref="UniSTS:61308"
STS 2303..2576
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="A006A17"
/db_xref="UniSTS:68860"
STS 2303..2576
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="G20648"
/db_xref="UniSTS:68859"
variation 2332
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:371394348"
variation 2346
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:146280734"
variation 2352
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:13467"
variation 2354
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185361860"
variation 2434
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:377058344"
variation 2485
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:189170661"
polyA_signal 2535..2540
/gene="NEK6"
/gene_synonym="SID6-1512"
polyA_site 2584
/gene="NEK6"
/gene_synonym="SID6-1512"
ORIGIN
cacccaccccagcccagagaggcgacccagctccctggaggcccaggcacctcatgtctgccctcaacccagagtggagcagaccttccctggagcttctcaggagccacttcaaaagttcgtgccctcgtgaggctggcatgcaggatggcaggacagcccggccacatgccccatggagggagttccaacaacctctgccacaccctggggcctgtgcatcctcctgacccacagaggcatcccaacacgctgtcttttcgctgctcgctggcggacttccagatcgaaaagaagataggccgaggacagttcagcgaggtgtacaaggccacctgcctgctggacaggaagacagtggctctgaagaaggtgcagatctttgagatgatggacgccaaggcgaggcaggactgtgtcaaggagatcggcctcttgaagcaactgaaccacccaaatatcatcaagtatttggactcgtttatcgaagacaacgagctgaacattgtgctggagttggctgacgcaggggacctctcgcagatgatcaagtactttaagaagcagaagcggctcatcccggagaggacagtatggaagtactttgtgcagctgtgcagcgccgtggagcacatgcattcacgccgggtgatgcaccgagacatcaagcctgccaacgtgttcatcacagccacgggcgtcgtgaagctcggtgaccttggtctgggccgcttcttcagctctgagaccaccgcagcccactccctagtggggacgccctactacatgtcaccggagaggatccatgagaacggctacaacttcaagtccgacatctggtccctgggctgtctgctgtacgagatggcagccctccagagccccttctatggagataagatgaatctcttctccctgtgccagaagatcgagcagtgtgactaccccccactccccggggagcactactccgagaagttacgagaactggtcagcatgtgcatctgccctgacccccaccagagacctgacatcggatacgtgcaccaggtggccaagcagatgcacatctggatgtccagcacctgagcgtggatgcaccgtgccttatcaaagccagcaccactttgccttacttgagtcgtcttctcttcgagtggccacctggtagcctagaacagctaagaccacagggttcagcaggttccccaaaaggctgcccagccttacagcagatgctgaaggcagagcagctgagggaggggcgctggccacatgtcactgatggtcagattccaaagtcctttctttatactgttgtggacaatctcagctgggtcaataagggcaggtggttcagcgagccacggcagccccctgtatctggattgtaatgtgaatctttagggtaattcctccagtgacctgtcaaggcttatgctaacaggagacttgcaggagaccgtgtgatttgtgtagtgagcctttgaaaatggttagtaccgggttcagtttagttcttagtatcttttcaatcaagctgtgtgcttaatttactctgttgtaaagggataaagtggaaatcatttttttccgtggagtggtgattctgctaacatttttatctacgttttataacttggtgagtgacgatgagagccctgcacctggccagagtgtcacaggcaaaaggcatcgggaagcaggagcatcttcttggcagccaggctgggccatcttctcctggacacctgctgtgtaccaggaacttcgtcacctccttgaatgctggcggttcatttcatgatcagtgttaagcattttcctccatgggaaggaagcatgggatatagaaaagcgaagggctgtcctttacaaattctggttctgcaacttcctagcgtgactttgggcttgggcaagtttcttagccgttctgagccttcatttcctcatctgtacaatgagattaatagtacctatcatctaccttcaggattgctgacagacagaatttgaaataaaatatgcaagttagctaatacaaaaagtagatgatccaaaaatggtagccactcacccttcacaaactgaagtccatggaccacggaagtcgagaattaatgtacacctgtatcatgtgtaggaaaccagaaatgtgttccttatttcttgttcccaaacaggattaactgtgaagactaatttataaatgtgaacctaagaaaactccacctctgaaggaaatcatttgaattttgtttttgtacgtaaagttaaccttccaattgtctgagctgtcgtcactgacttcatgacagtctggccctccagacaagagcagcgctggcatcgggcaggtgattcctgacacctgctgcctgcaggcattcactgaccaggcctttcctggaggaaacacccagggccgggcggctgctgtttccacacgtggactcggatctgctgtgacaccgtcagcccgacagtctctccatatgcagcctttcctctgtacttttctccatggttgaaataaaacagggtgactgggagttacttagaattcatgaagattttaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10783 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004871 [signal transducer activity] evidence: IMP
GeneID:10783 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0005524 [ATP binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0019894 [kinesin binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:10783 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0000910 [cytokinesis] evidence: TAS
GeneID:10783 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10783 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
GeneID:10783 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:10783 -> Biological process: GO:0007077 [mitotic nuclear envelope disassembly] evidence: TAS
GeneID:10783 -> Biological process: GO:0007165 [signal transduction] evidence: IMP
GeneID:10783 -> Biological process: GO:0007346 [regulation of mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0030071 [regulation of mitotic metaphase/anaphase transition] evidence: IDA
GeneID:10783 -> Biological process: GO:0031572 [G2 DNA damage checkpoint] evidence: IMP
GeneID:10783 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IMP
GeneID:10783 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0051225 [spindle assembly] evidence: TAS
GeneID:10783 -> Biological process: GO:2000772 [regulation of cellular senescence] evidence: TAS
GeneID:10783 -> Cellular component: GO:0000922 [spindle pole] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10783 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
GeneID:10783 -> Cellular component: GO:0016607 [nuclear speck] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001159642 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.