Home |
Help |
Advanced search
2024-04-20 04:18:55, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001166169 2596 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens NIMA-related kinase 6 (NEK6), transcript variant 4,
mRNA.
ACCESSION NM_001166169
VERSION NM_001166169.1 GI:261244924
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2596)
AUTHORS Cao,X., Xia,Y., Yang,J., Jiang,J., Chen,L., Ni,R., Li,L. and Gu,Z.
TITLE Clinical and biological significance of never in mitosis gene
A-related kinase 6 (NEK6) expression in hepatic cell cancer
JOURNAL Pathol. Oncol. Res. 18 (2), 201-207 (2012)
PUBMED 21725899
REMARK GeneRIF: High Nek6 is associated with hepatic cell cancer.
REFERENCE 2 (bases 1 to 2596)
AUTHORS Bertran,M.T., Sdelci,S., Regue,L., Avruch,J., Caelles,C. and
Roig,J.
TITLE Nek9 is a Plk1-activated kinase that controls early centrosome
separation through Nek6/7 and Eg5
JOURNAL EMBO J. 30 (13), 2634-2647 (2011)
PUBMED 21642957
REMARK GeneRIF: Nek9 is a Plk1-activated kinase that controls early
centrosome separation through Nek6/7 and Eg5.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2596)
AUTHORS Jee,H.J., Kim,H.J., Kim,A.J., Song,N., Kim,M. and Yun,J.
TITLE Nek6 suppresses the premature senescence of human cancer cells
induced by camptothecin and doxorubicin treatment
JOURNAL Biochem. Biophys. Res. Commun. 408 (4), 669-673 (2011)
PUBMED 21539811
REMARK GeneRIF: These results suggest that the increased expression of
Nek6 renders cancer cells resistant to premature senescence, and
targeting Nek6 could be an efficient strategy for cancer treatment.
REFERENCE 4 (bases 1 to 2596)
AUTHORS Regue,L., Sdelci,S., Bertran,M.T., Caelles,C., Reverter,D. and
Roig,J.
TITLE DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9
JOURNAL J. Biol. Chem. 286 (20), 18118-18129 (2011)
PUBMED 21454704
REMARK GeneRIF: DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
REFERENCE 5 (bases 1 to 2596)
AUTHORS Meirelles,G.V., Silva,J.C., Mendonca Yde,A., Ramos,C.H.,
Torriani,I.L. and Kobarg,J.
TITLE Human Nek6 is a monomeric mostly globular kinase with an unfolded
short N-terminal domain
JOURNAL BMC Struct. Biol. 11, 12 (2011)
PUBMED 21320329
REMARK GeneRIF: the first low resolution 3D structure of hNek6 protein in
solution
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2596)
AUTHORS Belham,C., Comb,M.J. and Avruch,J.
TITLE Identification of the NIMA family kinases NEK6/7 as regulators of
the p70 ribosomal S6 kinase
JOURNAL Curr. Biol. 11 (15), 1155-1167 (2001)
PUBMED 11516946
REFERENCE 7 (bases 1 to 2596)
AUTHORS Kimura,M. and Okano,Y.
TITLE Identification and assignment of the human NIMA-related protein
kinase 7 gene (NEK7) to human chromosome 1q31.3
JOURNAL Cytogenet. Cell Genet. 94 (1-2), 33-38 (2001)
PUBMED 11701951
REMARK GeneRIF: Also includes phylogenetic analysis and tissue-specific
RT-PCR of human NEK6 and NEK7.
REFERENCE 8 (bases 1 to 2596)
AUTHORS Kandli,M., Feige,E., Chen,A., Kilfin,G. and Motro,B.
TITLE Isolation and characterization of two evolutionarily conserved
murine kinases (Nek6 and nek7) related to the fungal mitotic
regulator, NIMA
JOURNAL Genomics 68 (2), 187-196 (2000)
PUBMED 10964517
REFERENCE 9 (bases 1 to 2596)
AUTHORS Kobayashi,T. and Cohen,P.
TITLE Activation of serum- and glucocorticoid-regulated protein kinase by
agonists that activate phosphatidylinositide 3-kinase is mediated
by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2
JOURNAL Biochem. J. 339 (PT 2), 319-328 (1999)
PUBMED 10191262
REFERENCE 10 (bases 1 to 2596)
AUTHORS Li,M.Z., Yu,L., Liu,Q., Chu,J.Y. and Zhao,S.Y.
TITLE Assignment of NEK6, a NIMA-related gene, to human chromosome 9q33.
3-->q34.11 by radiation hybrid mapping
JOURNAL Cytogenet. Cell Genet. 87 (3-4), 271-272 (1999)
PUBMED 10702691
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK294614.1, AL162724.16,
AL137846.24 and BC012761.2.
Summary: The protein encoded by this gene is a kinase required for
progression through the metaphase portion of mitosis. Inhibition of
the encoded protein can lead to apoptosis. This protein also can
enhance tumorigenesis by suppressing tumor cell senescence. Several
transcript variants encoding a few different isoforms have been
found for this gene. [provided by RefSeq, Oct 2011].
Transcript Variant: This variant (4) differs in the 5' UTR, lacks a
portion of the 5' coding region, and initiates translation at an
alternate start codon, compared to variant 1. The encoded isoform
(4) has a distinct N-terminus and is shorter than isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK294614.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-120 AK294614.1 1-120
121-239 AL162724.16 98558-98676
240-380 AL162724.16 109131-109271
381-443 AL162724.16 110545-110607
444-554 AL162724.16 118081-118191
555-663 AL137846.24 510-618
664-771 AL137846.24 1518-1625
772-866 AL137846.24 13751-13845
867-980 AL137846.24 21889-22002
981-1575 AL137846.24 25017-25611
1576-2596 BC012761.2 1572-2592
FEATURES Location/Qualifiers
source 1..2596
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/map="9q33.3-q34.11"
gene 1..2596
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="NIMA-related kinase 6"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
exon 1..120
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 43
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="g"
/replace="t"
/db_xref="dbSNP:12682747"
CDS 75..1091
/gene="NEK6"
/gene_synonym="SID6-1512"
/EC_number="2.7.11.1"
/note="isoform 4 is encoded by transcript variant 4;
putative serine-threonine protein kinase;
serine/threonine-protein kinase Nek6; protein kinase
SID6-1512; nimA-related protein kinase 6; never in mitosis
A-related kinase 6; NIMA (never in mitosis gene a)-related
kinase 6"
/codon_start=1
/product="serine/threonine-protein kinase Nek6 isoform 4"
/protein_id="NP_001159641.1"
/db_xref="GI:261244925"
/db_xref="CCDS:CCDS55339.1"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
/translation="
MEATGWDSRCSPGTQVRALVRLACRMAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
"
misc_feature 273..1070
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Catalytic domain of the Protein Serine/Threonine
Kinases, Never In Mitosis gene A-related kinase 6 and 7;
Region: STKc_Nek6_Nek7; cd08224"
/db_xref="CDD:173764"
misc_feature 282..1079
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(300..314,324..326,363..365,369..371,465..467,
513..524,534..536,540..542,663..665,669..671,675..680,
684..686,717..719,726..728,732..734,774..785)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="active site"
/db_xref="CDD:173764"
misc_feature order(300..305,309..314,324..326,363..365,369..371,
465..467,516..524,534..536,678..680,684..686,732..734)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173764"
misc_feature order(312..314,534..536,540..542,663..665,669..671,
675..677,726..728,774..785)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173764"
misc_feature 714..785
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173764"
variation 101
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:373723730"
exon 121..239
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 131
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:373043424"
variation 136
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:79304695"
variation 178
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:377403028"
variation 197
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:145488745"
variation 206
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:35882196"
variation 225
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140978005"
exon 240..380
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 254
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:116276253"
variation 277
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:183673274"
variation 291
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:148262318"
exon 381..443
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 398
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:141841414"
variation 410
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200803888"
variation 419
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:150614386"
variation 424
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:183711992"
exon 444..554
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 446
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:138847171"
variation 458
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:199829118"
variation 482
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186179243"
variation 490
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:370008827"
variation 498
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:143094065"
variation 500
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:115563387"
exon 555..663
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 582
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:11556892"
variation 583
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:368466543"
variation 584
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:372516510"
variation 596
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:375715210"
variation 622
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200565078"
variation 632
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201692889"
variation 645
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:369950028"
exon 664..771
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 701
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:147517890"
variation 726
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140109985"
variation 734
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144636007"
variation 736
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="g"
/replace="t"
/db_xref="dbSNP:200086787"
variation 740
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:201207004"
variation 755
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:145520134"
exon 772..866
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 833
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144397688"
variation 839
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:201833354"
variation 846
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:10760354"
variation 863
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:200895433"
exon 867..980
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 890
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:142081750"
variation 905
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:151138282"
variation 929
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191153129"
variation 959
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201681080"
variation 974
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140302963"
variation 975
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:144052872"
exon 981..2586
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 985
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200398623"
variation 1000
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201113183"
variation 1020
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:146443565"
variation 1043
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375270617"
variation 1044
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200235098"
variation 1050
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:376476122"
variation 1055
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141017419"
variation 1064
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200021823"
variation 1093
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:370917966"
variation 1104
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375568776"
STS 1105..1255
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11482"
/db_xref="UniSTS:58088"
variation 1105
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201649447"
variation 1208..1209
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="c"
/db_xref="dbSNP:36107117"
variation 1294
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:138529813"
STS 1316..1576
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH12239"
/db_xref="UniSTS:63110"
variation 1430
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:187874166"
STS 1435..1584
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="SGC33089"
/db_xref="UniSTS:78220"
variation 1466
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:190024004"
variation 1467
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:142713923"
variation 1479
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:58099088"
variation 1525
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:2416"
variation 1534..1535
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="tcaa"
/db_xref="dbSNP:374990567"
variation 1593
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:146937021"
variation 1595
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:77933598"
variation 1597
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:12555646"
variation 1654
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:182662225"
variation 1666
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:147972018"
variation 1688
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186630550"
variation 1775
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191474528"
variation 1795
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185386620"
variation 1835
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141687734"
variation 1905
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:28687204"
variation 1956
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:11556890"
variation 1992
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:189086459"
STS 2064..2197
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH77983"
/db_xref="UniSTS:226"
variation 2133
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:192831011"
variation 2174
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:150524435"
variation 2183
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="t"
/db_xref="dbSNP:139595461"
variation 2188
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:76125733"
STS 2282..2519
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11599"
/db_xref="UniSTS:61308"
STS 2305..2578
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="A006A17"
/db_xref="UniSTS:68860"
STS 2305..2578
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="G20648"
/db_xref="UniSTS:68859"
variation 2334
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:371394348"
variation 2348
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:146280734"
variation 2354
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:13467"
variation 2356
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185361860"
variation 2436
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:377058344"
variation 2487
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:189170661"
polyA_signal 2537..2542
/gene="NEK6"
/gene_synonym="SID6-1512"
polyA_site 2586
/gene="NEK6"
/gene_synonym="SID6-1512"
ORIGIN
ttttgtctgccccttcctgcctgtgggaaggagagaaaattaggggaggccacgggcttgaaagctttccctgcatggaggccactggatgggattctagatgctcgcctgggacccaggttcgtgccctcgtgaggctggcatgcaggatggcaggacagcccggccacatgccccatggagggagttccaacaacctctgccacaccctggggcctgtgcatcctcctgacccacagaggcatcccaacacgctgtcttttcgctgctcgctggcggacttccagatcgaaaagaagataggccgaggacagttcagcgaggtgtacaaggccacctgcctgctggacaggaagacagtggctctgaagaaggtgcagatctttgagatgatggacgccaaggcgaggcaggactgtgtcaaggagatcggcctcttgaagcaactgaaccacccaaatatcatcaagtatttggactcgtttatcgaagacaacgagctgaacattgtgctggagttggctgacgcaggggacctctcgcagatgatcaagtactttaagaagcagaagcggctcatcccggagaggacagtatggaagtactttgtgcagctgtgcagcgccgtggagcacatgcattcacgccgggtgatgcaccgagacatcaagcctgccaacgtgttcatcacagccacgggcgtcgtgaagctcggtgaccttggtctgggccgcttcttcagctctgagaccaccgcagcccactccctagtggggacgccctactacatgtcaccggagaggatccatgagaacggctacaacttcaagtccgacatctggtccctgggctgtctgctgtacgagatggcagccctccagagccccttctatggagataagatgaatctcttctccctgtgccagaagatcgagcagtgtgactaccccccactccccggggagcactactccgagaagttacgagaactggtcagcatgtgcatctgccctgacccccaccagagacctgacatcggatacgtgcaccaggtggccaagcagatgcacatctggatgtccagcacctgagcgtggatgcaccgtgccttatcaaagccagcaccactttgccttacttgagtcgtcttctcttcgagtggccacctggtagcctagaacagctaagaccacagggttcagcaggttccccaaaaggctgcccagccttacagcagatgctgaaggcagagcagctgagggaggggcgctggccacatgtcactgatggtcagattccaaagtcctttctttatactgttgtggacaatctcagctgggtcaataagggcaggtggttcagcgagccacggcagccccctgtatctggattgtaatgtgaatctttagggtaattcctccagtgacctgtcaaggcttatgctaacaggagacttgcaggagaccgtgtgatttgtgtagtgagcctttgaaaatggttagtaccgggttcagtttagttcttagtatcttttcaatcaagctgtgtgcttaatttactctgttgtaaagggataaagtggaaatcatttttttccgtggagtggtgattctgctaacatttttatctacgttttataacttggtgagtgacgatgagagccctgcacctggccagagtgtcacaggcaaaaggcatcgggaagcaggagcatcttcttggcagccaggctgggccatcttctcctggacacctgctgtgtaccaggaacttcgtcacctccttgaatgctggcggttcatttcatgatcagtgttaagcattttcctccatgggaaggaagcatgggatatagaaaagcgaagggctgtcctttacaaattctggttctgcaacttcctagcgtgactttgggcttgggcaagtttcttagccgttctgagccttcatttcctcatctgtacaatgagattaatagtacctatcatctaccttcaggattgctgacagacagaatttgaaataaaatatgcaagttagctaatacaaaaagtagatgatccaaaaatggtagccactcacccttcacaaactgaagtccatggaccacggaagtcgagaattaatgtacacctgtatcatgtgtaggaaaccagaaatgtgttccttatttcttgttcccaaacaggattaactgtgaagactaatttataaatgtgaacctaagaaaactccacctctgaaggaaatcatttgaattttgtttttgtacgtaaagttaaccttccaattgtctgagctgtcgtcactgacttcatgacagtctggccctccagacaagagcagcgctggcatcgggcaggtgattcctgacacctgctgcctgcaggcattcactgaccaggcctttcctggaggaaacacccagggccgggcggctgctgtttccacacgtggactcggatctgctgtgacaccgtcagcccgacagtctctccatatgcagcctttcctctgtacttttctccatggttgaaataaaacagggtgactgggagttacttagaattcatgaagattttaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10783 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004871 [signal transducer activity] evidence: IMP
GeneID:10783 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0005524 [ATP binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0019894 [kinesin binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:10783 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0000910 [cytokinesis] evidence: TAS
GeneID:10783 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10783 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
GeneID:10783 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:10783 -> Biological process: GO:0007077 [mitotic nuclear envelope disassembly] evidence: TAS
GeneID:10783 -> Biological process: GO:0007165 [signal transduction] evidence: IMP
GeneID:10783 -> Biological process: GO:0007346 [regulation of mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0030071 [regulation of mitotic metaphase/anaphase transition] evidence: IDA
GeneID:10783 -> Biological process: GO:0031572 [G2 DNA damage checkpoint] evidence: IMP
GeneID:10783 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IMP
GeneID:10783 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0051225 [spindle assembly] evidence: TAS
GeneID:10783 -> Biological process: GO:2000772 [regulation of cellular senescence] evidence: TAS
GeneID:10783 -> Cellular component: GO:0000922 [spindle pole] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10783 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
GeneID:10783 -> Cellular component: GO:0016607 [nuclear speck] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001159641 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.