Home |
Help |
Advanced search
2024-04-25 20:10:05, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001166168 2587 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens NIMA-related kinase 6 (NEK6), transcript variant 5,
mRNA.
ACCESSION NM_001166168
VERSION NM_001166168.1 GI:261244922
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2587)
AUTHORS Cao,X., Xia,Y., Yang,J., Jiang,J., Chen,L., Ni,R., Li,L. and Gu,Z.
TITLE Clinical and biological significance of never in mitosis gene
A-related kinase 6 (NEK6) expression in hepatic cell cancer
JOURNAL Pathol. Oncol. Res. 18 (2), 201-207 (2012)
PUBMED 21725899
REMARK GeneRIF: High Nek6 is associated with hepatic cell cancer.
REFERENCE 2 (bases 1 to 2587)
AUTHORS Bertran,M.T., Sdelci,S., Regue,L., Avruch,J., Caelles,C. and
Roig,J.
TITLE Nek9 is a Plk1-activated kinase that controls early centrosome
separation through Nek6/7 and Eg5
JOURNAL EMBO J. 30 (13), 2634-2647 (2011)
PUBMED 21642957
REMARK GeneRIF: Nek9 is a Plk1-activated kinase that controls early
centrosome separation through Nek6/7 and Eg5.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2587)
AUTHORS Jee,H.J., Kim,H.J., Kim,A.J., Song,N., Kim,M. and Yun,J.
TITLE Nek6 suppresses the premature senescence of human cancer cells
induced by camptothecin and doxorubicin treatment
JOURNAL Biochem. Biophys. Res. Commun. 408 (4), 669-673 (2011)
PUBMED 21539811
REMARK GeneRIF: These results suggest that the increased expression of
Nek6 renders cancer cells resistant to premature senescence, and
targeting Nek6 could be an efficient strategy for cancer treatment.
REFERENCE 4 (bases 1 to 2587)
AUTHORS Regue,L., Sdelci,S., Bertran,M.T., Caelles,C., Reverter,D. and
Roig,J.
TITLE DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9
JOURNAL J. Biol. Chem. 286 (20), 18118-18129 (2011)
PUBMED 21454704
REMARK GeneRIF: DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
REFERENCE 5 (bases 1 to 2587)
AUTHORS Meirelles,G.V., Silva,J.C., Mendonca Yde,A., Ramos,C.H.,
Torriani,I.L. and Kobarg,J.
TITLE Human Nek6 is a monomeric mostly globular kinase with an unfolded
short N-terminal domain
JOURNAL BMC Struct. Biol. 11, 12 (2011)
PUBMED 21320329
REMARK GeneRIF: the first low resolution 3D structure of hNek6 protein in
solution
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2587)
AUTHORS Belham,C., Comb,M.J. and Avruch,J.
TITLE Identification of the NIMA family kinases NEK6/7 as regulators of
the p70 ribosomal S6 kinase
JOURNAL Curr. Biol. 11 (15), 1155-1167 (2001)
PUBMED 11516946
REFERENCE 7 (bases 1 to 2587)
AUTHORS Kimura,M. and Okano,Y.
TITLE Identification and assignment of the human NIMA-related protein
kinase 7 gene (NEK7) to human chromosome 1q31.3
JOURNAL Cytogenet. Cell Genet. 94 (1-2), 33-38 (2001)
PUBMED 11701951
REMARK GeneRIF: Also includes phylogenetic analysis and tissue-specific
RT-PCR of human NEK6 and NEK7.
REFERENCE 8 (bases 1 to 2587)
AUTHORS Kandli,M., Feige,E., Chen,A., Kilfin,G. and Motro,B.
TITLE Isolation and characterization of two evolutionarily conserved
murine kinases (Nek6 and nek7) related to the fungal mitotic
regulator, NIMA
JOURNAL Genomics 68 (2), 187-196 (2000)
PUBMED 10964517
REFERENCE 9 (bases 1 to 2587)
AUTHORS Kobayashi,T. and Cohen,P.
TITLE Activation of serum- and glucocorticoid-regulated protein kinase by
agonists that activate phosphatidylinositide 3-kinase is mediated
by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2
JOURNAL Biochem. J. 339 (PT 2), 319-328 (1999)
PUBMED 10191262
REFERENCE 10 (bases 1 to 2587)
AUTHORS Li,M.Z., Yu,L., Liu,Q., Chu,J.Y. and Zhao,S.Y.
TITLE Assignment of NEK6, a NIMA-related gene, to human chromosome 9q33.
3-->q34.11 by radiation hybrid mapping
JOURNAL Cytogenet. Cell Genet. 87 (3-4), 271-272 (1999)
PUBMED 10702691
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BP279761.1, BC012761.2,
AL137846.24 and AF087909.1.
Summary: The protein encoded by this gene is a kinase required for
progression through the metaphase portion of mitosis. Inhibition of
the encoded protein can lead to apoptosis. This protein also can
enhance tumorigenesis by suppressing tumor cell senescence. Several
transcript variants encoding a few different isoforms have been
found for this gene. [provided by RefSeq, Oct 2011].
Transcript Variant: This variant (5) differs in the 5' UTR, lacks a
portion of the 5' coding region, and initiates translation at a
downstream start codon, compared to variant 1. The encoded isoform
(2) is shorter than isoform 1. Variants 2, 5 and 6 encode the same
isoform (2).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK313071.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025086, ERS025090 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-111 BP279761.1 1-111
112-836 BC012761.2 117-841
837-837 AL137846.24 13825-13825
838-1515 BC012761.2 843-1520
1516-1516 AF087909.1 1510-1510
1517-2587 BC012761.2 1522-2592
FEATURES Location/Qualifiers
source 1..2587
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/map="9q33.3-q34.11"
gene 1..2587
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="NIMA-related kinase 6"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
exon 1..111
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 16
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:3983850"
variation 33
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:7040074"
variation 65
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:146647752"
exon 112..230
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 122
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:373043424"
variation 127
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:79304695"
CDS 141..1082
/gene="NEK6"
/gene_synonym="SID6-1512"
/EC_number="2.7.11.1"
/note="isoform 2 is encoded by transcript variant 5;
putative serine-threonine protein kinase;
serine/threonine-protein kinase Nek6; protein kinase
SID6-1512; nimA-related protein kinase 6; never in mitosis
A-related kinase 6; NIMA (never in mitosis gene a)-related
kinase 6"
/codon_start=1
/product="serine/threonine-protein kinase Nek6 isoform 2"
/protein_id="NP_001159640.1"
/db_xref="GI:261244923"
/db_xref="CCDS:CCDS6854.1"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
/translation="
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
"
misc_feature 141..272
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9HC98.2);
Region: Interaction with ARHGAP33, ANKRA2, CDC42, PRDX3,
RAD26L, RBBP6, RPS7 and TRIP4"
misc_feature 249..251
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9HC98.2); phosphorylation site"
misc_feature 264..1061
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Catalytic domain of the Protein Serine/Threonine
Kinases, Never In Mitosis gene A-related kinase 6 and 7;
Region: STKc_Nek6_Nek7; cd08224"
/db_xref="CDD:173764"
misc_feature 273..1070
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(291..305,315..317,354..356,360..362,456..458,
504..515,525..527,531..533,654..656,660..662,666..671,
675..677,708..710,717..719,723..725,765..776)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="active site"
/db_xref="CDD:173764"
misc_feature order(291..296,300..305,315..317,354..356,360..362,
456..458,507..515,525..527,669..671,675..677,723..725)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173764"
misc_feature order(303..305,525..527,531..533,654..656,660..662,
666..668,717..719,765..776)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173764"
misc_feature 462..464
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Autoinhibitory; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); other site"
misc_feature 705..776
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173764"
misc_feature 744..746
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 756..758
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by NEK9; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 768..770
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 939..950
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9HC98.2);
Region: Interaction with APBB1"
variation 169
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:377403028"
variation 188
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:145488745"
variation 197
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:35882196"
variation 216
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140978005"
exon 231..371
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 245
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:116276253"
variation 268
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:183673274"
variation 282
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:148262318"
exon 372..434
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 389
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:141841414"
variation 401
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200803888"
variation 410
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:150614386"
variation 415
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:183711992"
exon 435..545
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 437
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:138847171"
variation 449
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:199829118"
variation 473
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186179243"
variation 481
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:370008827"
variation 489
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:143094065"
variation 491
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:115563387"
exon 546..654
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 573
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:11556892"
variation 574
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:368466543"
variation 575
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:372516510"
variation 587
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:375715210"
variation 613
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200565078"
variation 623
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201692889"
variation 636
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:369950028"
exon 655..762
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 692
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:147517890"
variation 717
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140109985"
variation 725
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144636007"
variation 727
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="g"
/replace="t"
/db_xref="dbSNP:200086787"
variation 731
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:201207004"
variation 746
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:145520134"
exon 763..857
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 824
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144397688"
variation 830
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:201833354"
variation 837
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:10760354"
variation 854
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:200895433"
exon 858..971
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 881
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:142081750"
variation 896
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:151138282"
variation 920
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191153129"
variation 950
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201681080"
variation 965
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140302963"
variation 966
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:144052872"
exon 972..2577
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 976
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200398623"
variation 991
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201113183"
variation 1011
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:146443565"
variation 1034
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375270617"
variation 1035
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200235098"
variation 1041
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:376476122"
variation 1046
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141017419"
variation 1055
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200021823"
variation 1084
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:370917966"
variation 1095
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375568776"
STS 1096..1246
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11482"
/db_xref="UniSTS:58088"
variation 1096
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201649447"
variation 1199..1200
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="c"
/db_xref="dbSNP:36107117"
variation 1285
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:138529813"
STS 1307..1567
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH12239"
/db_xref="UniSTS:63110"
variation 1421
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:187874166"
STS 1426..1575
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="SGC33089"
/db_xref="UniSTS:78220"
variation 1457
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:190024004"
variation 1458
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:142713923"
variation 1470
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:58099088"
variation 1516
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:2416"
variation 1525..1526
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="tcaa"
/db_xref="dbSNP:374990567"
variation 1584
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:146937021"
variation 1586
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:77933598"
variation 1588
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:12555646"
variation 1645
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:182662225"
variation 1657
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:147972018"
variation 1679
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186630550"
variation 1766
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191474528"
variation 1786
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185386620"
variation 1826
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141687734"
variation 1896
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:28687204"
variation 1947
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:11556890"
variation 1983
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:189086459"
STS 2055..2188
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH77983"
/db_xref="UniSTS:226"
variation 2124
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:192831011"
variation 2165
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:150524435"
variation 2174
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="t"
/db_xref="dbSNP:139595461"
variation 2179
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:76125733"
STS 2273..2510
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11599"
/db_xref="UniSTS:61308"
STS 2296..2569
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="A006A17"
/db_xref="UniSTS:68860"
STS 2296..2569
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="G20648"
/db_xref="UniSTS:68859"
variation 2325
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:371394348"
variation 2339
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:146280734"
variation 2345
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:13467"
variation 2347
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185361860"
variation 2427
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:377058344"
variation 2478
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:189170661"
polyA_signal 2528..2533
/gene="NEK6"
/gene_synonym="SID6-1512"
polyA_site 2577
/gene="NEK6"
/gene_synonym="SID6-1512"
ORIGIN
gagcgtgtcggcggccgggcgggcgggggcggcgtgtccgcgtgtcccggggtgtgcgcgtccccggcgggtgtgcgtgtgcaccccggagcgtctggtggcgttgttgggttcgtgccctcgtgaggctggcatgcaggatggcaggacagcccggccacatgccccatggagggagttccaacaacctctgccacaccctggggcctgtgcatcctcctgacccacagaggcatcccaacacgctgtcttttcgctgctcgctggcggacttccagatcgaaaagaagataggccgaggacagttcagcgaggtgtacaaggccacctgcctgctggacaggaagacagtggctctgaagaaggtgcagatctttgagatgatggacgccaaggcgaggcaggactgtgtcaaggagatcggcctcttgaagcaactgaaccacccaaatatcatcaagtatttggactcgtttatcgaagacaacgagctgaacattgtgctggagttggctgacgcaggggacctctcgcagatgatcaagtactttaagaagcagaagcggctcatcccggagaggacagtatggaagtactttgtgcagctgtgcagcgccgtggagcacatgcattcacgccgggtgatgcaccgagacatcaagcctgccaacgtgttcatcacagccacgggcgtcgtgaagctcggtgaccttggtctgggccgcttcttcagctctgagaccaccgcagcccactccctagtggggacgccctactacatgtcaccggagaggatccatgagaacggctacaacttcaagtccgacatctggtccctgggctgtctgctgtacgagatggcagccctccagagccccttctatggagataagatgaatctcttctccctgtgccagaagatcgagcagtgtgactaccccccactccccggggagcactactccgagaagttacgagaactggtcagcatgtgcatctgccctgacccccaccagagacctgacatcggatacgtgcaccaggtggccaagcagatgcacatctggatgtccagcacctgagcgtggatgcaccgtgccttatcaaagccagcaccactttgccttacttgagtcgtcttctcttcgagtggccacctggtagcctagaacagctaagaccacagggttcagcaggttccccaaaaggctgcccagccttacagcagatgctgaaggcagagcagctgagggaggggcgctggccacatgtcactgatggtcagattccaaagtcctttctttatactgttgtggacaatctcagctgggtcaataagggcaggtggttcagcgagccacggcagccccctgtatctggattgtaatgtgaatctttagggtaattcctccagtgacctgtcaaggcttatgctaacaggagacttgcaggagaccgtgtgatttgtgtagtgagcctttgaaaatggttagtaccgggttcagtttagttcttagtatcttttcaatcaagctgtgtgcttaatttactctgttgtaaagggataaagtggaaatcatttttttccgtggagtggtgattctgctaacatttttatctacgttttataacttggtgagtgacgatgagagccctgcacctggccagagtgtcacaggcaaaaggcatcgggaagcaggagcatcttcttggcagccaggctgggccatcttctcctggacacctgctgtgtaccaggaacttcgtcacctccttgaatgctggcggttcatttcatgatcagtgttaagcattttcctccatgggaaggaagcatgggatatagaaaagcgaagggctgtcctttacaaattctggttctgcaacttcctagcgtgactttgggcttgggcaagtttcttagccgttctgagccttcatttcctcatctgtacaatgagattaatagtacctatcatctaccttcaggattgctgacagacagaatttgaaataaaatatgcaagttagctaatacaaaaagtagatgatccaaaaatggtagccactcacccttcacaaactgaagtccatggaccacggaagtcgagaattaatgtacacctgtatcatgtgtaggaaaccagaaatgtgttccttatttcttgttcccaaacaggattaactgtgaagactaatttataaatgtgaacctaagaaaactccacctctgaaggaaatcatttgaattttgtttttgtacgtaaagttaaccttccaattgtctgagctgtcgtcactgacttcatgacagtctggccctccagacaagagcagcgctggcatcgggcaggtgattcctgacacctgctgcctgcaggcattcactgaccaggcctttcctggaggaaacacccagggccgggcggctgctgtttccacacgtggactcggatctgctgtgacaccgtcagcccgacagtctctccatatgcagcctttcctctgtacttttctccatggttgaaataaaacagggtgactgggagttacttagaattcatgaagattttaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10783 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004871 [signal transducer activity] evidence: IMP
GeneID:10783 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0005524 [ATP binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0019894 [kinesin binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:10783 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0000910 [cytokinesis] evidence: TAS
GeneID:10783 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10783 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
GeneID:10783 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:10783 -> Biological process: GO:0007077 [mitotic nuclear envelope disassembly] evidence: TAS
GeneID:10783 -> Biological process: GO:0007165 [signal transduction] evidence: IMP
GeneID:10783 -> Biological process: GO:0007346 [regulation of mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0030071 [regulation of mitotic metaphase/anaphase transition] evidence: IDA
GeneID:10783 -> Biological process: GO:0031572 [G2 DNA damage checkpoint] evidence: IMP
GeneID:10783 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IMP
GeneID:10783 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0051225 [spindle assembly] evidence: TAS
GeneID:10783 -> Biological process: GO:2000772 [regulation of cellular senescence] evidence: TAS
GeneID:10783 -> Cellular component: GO:0000922 [spindle pole] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10783 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
GeneID:10783 -> Cellular component: GO:0016607 [nuclear speck] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001159640 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.