Home |
Help |
Advanced search
2024-04-25 04:18:56, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001166167 2592 bp mRNA linear PRI 18-APR-2013
DEFINITION Homo sapiens NIMA-related kinase 6 (NEK6), transcript variant 3,
mRNA.
ACCESSION NM_001166167
VERSION NM_001166167.1 GI:261244920
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2592)
AUTHORS Cao,X., Xia,Y., Yang,J., Jiang,J., Chen,L., Ni,R., Li,L. and Gu,Z.
TITLE Clinical and biological significance of never in mitosis gene
A-related kinase 6 (NEK6) expression in hepatic cell cancer
JOURNAL Pathol. Oncol. Res. 18 (2), 201-207 (2012)
PUBMED 21725899
REMARK GeneRIF: High Nek6 is associated with hepatic cell cancer.
REFERENCE 2 (bases 1 to 2592)
AUTHORS Bertran,M.T., Sdelci,S., Regue,L., Avruch,J., Caelles,C. and
Roig,J.
TITLE Nek9 is a Plk1-activated kinase that controls early centrosome
separation through Nek6/7 and Eg5
JOURNAL EMBO J. 30 (13), 2634-2647 (2011)
PUBMED 21642957
REMARK GeneRIF: Nek9 is a Plk1-activated kinase that controls early
centrosome separation through Nek6/7 and Eg5.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2592)
AUTHORS Jee,H.J., Kim,H.J., Kim,A.J., Song,N., Kim,M. and Yun,J.
TITLE Nek6 suppresses the premature senescence of human cancer cells
induced by camptothecin and doxorubicin treatment
JOURNAL Biochem. Biophys. Res. Commun. 408 (4), 669-673 (2011)
PUBMED 21539811
REMARK GeneRIF: These results suggest that the increased expression of
Nek6 renders cancer cells resistant to premature senescence, and
targeting Nek6 could be an efficient strategy for cancer treatment.
REFERENCE 4 (bases 1 to 2592)
AUTHORS Regue,L., Sdelci,S., Bertran,M.T., Caelles,C., Reverter,D. and
Roig,J.
TITLE DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9
JOURNAL J. Biol. Chem. 286 (20), 18118-18129 (2011)
PUBMED 21454704
REMARK GeneRIF: DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
REFERENCE 5 (bases 1 to 2592)
AUTHORS Meirelles,G.V., Silva,J.C., Mendonca Yde,A., Ramos,C.H.,
Torriani,I.L. and Kobarg,J.
TITLE Human Nek6 is a monomeric mostly globular kinase with an unfolded
short N-terminal domain
JOURNAL BMC Struct. Biol. 11, 12 (2011)
PUBMED 21320329
REMARK GeneRIF: the first low resolution 3D structure of hNek6 protein in
solution
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2592)
AUTHORS Belham,C., Comb,M.J. and Avruch,J.
TITLE Identification of the NIMA family kinases NEK6/7 as regulators of
the p70 ribosomal S6 kinase
JOURNAL Curr. Biol. 11 (15), 1155-1167 (2001)
PUBMED 11516946
REFERENCE 7 (bases 1 to 2592)
AUTHORS Kimura,M. and Okano,Y.
TITLE Identification and assignment of the human NIMA-related protein
kinase 7 gene (NEK7) to human chromosome 1q31.3
JOURNAL Cytogenet. Cell Genet. 94 (1-2), 33-38 (2001)
PUBMED 11701951
REMARK GeneRIF: Also includes phylogenetic analysis and tissue-specific
RT-PCR of human NEK6 and NEK7.
REFERENCE 8 (bases 1 to 2592)
AUTHORS Kandli,M., Feige,E., Chen,A., Kilfin,G. and Motro,B.
TITLE Isolation and characterization of two evolutionarily conserved
murine kinases (Nek6 and nek7) related to the fungal mitotic
regulator, NIMA
JOURNAL Genomics 68 (2), 187-196 (2000)
PUBMED 10964517
REFERENCE 9 (bases 1 to 2592)
AUTHORS Kobayashi,T. and Cohen,P.
TITLE Activation of serum- and glucocorticoid-regulated protein kinase by
agonists that activate phosphatidylinositide 3-kinase is mediated
by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2
JOURNAL Biochem. J. 339 (PT 2), 319-328 (1999)
PUBMED 10191262
REFERENCE 10 (bases 1 to 2592)
AUTHORS Li,M.Z., Yu,L., Liu,Q., Chu,J.Y. and Zhao,S.Y.
TITLE Assignment of NEK6, a NIMA-related gene, to human chromosome 9q33.
3-->q34.11 by radiation hybrid mapping
JOURNAL Cytogenet. Cell Genet. 87 (3-4), 271-272 (1999)
PUBMED 10702691
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BM083872.1, BC012761.2,
AL137846.24 and AF087909.1.
Summary: The protein encoded by this gene is a kinase required for
progression through the metaphase portion of mitosis. Inhibition of
the encoded protein can lead to apoptosis. This protein also can
enhance tumorigenesis by suppressing tumor cell senescence. Several
transcript variants encoding a few different isoforms have been
found for this gene. [provided by RefSeq, Oct 2011].
Transcript Variant: This variant (3) differs in the 5' UTR, lacks a
portion of the 5' coding region, and initiates translation at an
alternate start codon, compared to variant 1. The encoded isoform
(3) has a distinct N-terminus and is shorter than isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC000101.2 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-116 BM083872.1 1-116
117-841 BC012761.2 117-841
842-842 AL137846.24 13825-13825
843-1520 BC012761.2 843-1520
1521-1521 AF087909.1 1510-1510
1522-2592 BC012761.2 1522-2592
FEATURES Location/Qualifiers
source 1..2592
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/map="9q33.3-q34.11"
gene 1..2592
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="NIMA-related kinase 6"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
exon 1..116
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 16
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:369922367"
misc_feature 53..55
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="upstream in-frame stop codon"
variation 72
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:139361501"
CDS 92..1087
/gene="NEK6"
/gene_synonym="SID6-1512"
/EC_number="2.7.11.1"
/note="isoform 3 is encoded by transcript variant 3;
putative serine-threonine protein kinase;
serine/threonine-protein kinase Nek6; protein kinase
SID6-1512; nimA-related protein kinase 6; never in mitosis
A-related kinase 6; NIMA (never in mitosis gene a)-related
kinase 6"
/codon_start=1
/product="serine/threonine-protein kinase Nek6 isoform 3"
/protein_id="NP_001159639.1"
/db_xref="GI:261244921"
/db_xref="CCDS:CCDS55338.1"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="MIM:604884"
/translation="
MGRRRPAPFRALVRLACRMAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
"
misc_feature 269..1066
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Catalytic domain of the Protein Serine/Threonine
Kinases, Never In Mitosis gene A-related kinase 6 and 7;
Region: STKc_Nek6_Nek7; cd08224"
/db_xref="CDD:173764"
misc_feature 278..1075
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(296..310,320..322,359..361,365..367,461..463,
509..520,530..532,536..538,659..661,665..667,671..676,
680..682,713..715,722..724,728..730,770..781)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="active site"
/db_xref="CDD:173764"
misc_feature order(296..301,305..310,320..322,359..361,365..367,
461..463,512..520,530..532,674..676,680..682,728..730)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173764"
misc_feature order(308..310,530..532,536..538,659..661,665..667,
671..673,722..724,770..781)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173764"
misc_feature 710..781
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173764"
exon 117..235
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 127
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:373043424"
variation 132
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:79304695"
variation 174
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:377403028"
variation 193
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:145488745"
variation 202
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:35882196"
variation 221
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140978005"
exon 236..376
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 250
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:116276253"
variation 273
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:183673274"
variation 287
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:148262318"
exon 377..439
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 394
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:141841414"
variation 406
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200803888"
variation 415
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:150614386"
variation 420
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:183711992"
exon 440..550
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 442
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:138847171"
variation 454
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:199829118"
variation 478
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186179243"
variation 486
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:370008827"
variation 494
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:143094065"
variation 496
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:115563387"
exon 551..659
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 578
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:11556892"
variation 579
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:368466543"
variation 580
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:372516510"
variation 592
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:375715210"
variation 618
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200565078"
variation 628
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201692889"
variation 641
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:369950028"
exon 660..767
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 697
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:147517890"
variation 722
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140109985"
variation 730
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144636007"
variation 732
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="g"
/replace="t"
/db_xref="dbSNP:200086787"
variation 736
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:201207004"
variation 751
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:145520134"
exon 768..862
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 829
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144397688"
variation 835
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:201833354"
variation 842
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:10760354"
variation 859
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:200895433"
exon 863..976
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 886
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:142081750"
variation 901
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:151138282"
variation 925
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191153129"
variation 955
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201681080"
variation 970
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140302963"
variation 971
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:144052872"
exon 977..2582
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 981
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200398623"
variation 996
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201113183"
variation 1016
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:146443565"
variation 1039
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375270617"
variation 1040
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200235098"
variation 1046
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:376476122"
variation 1051
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141017419"
variation 1060
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200021823"
variation 1089
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:370917966"
variation 1100
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375568776"
STS 1101..1251
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11482"
/db_xref="UniSTS:58088"
variation 1101
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201649447"
variation 1204..1205
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="c"
/db_xref="dbSNP:36107117"
variation 1290
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:138529813"
STS 1312..1572
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH12239"
/db_xref="UniSTS:63110"
variation 1426
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:187874166"
STS 1431..1580
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="SGC33089"
/db_xref="UniSTS:78220"
variation 1462
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:190024004"
variation 1463
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:142713923"
variation 1475
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:58099088"
variation 1521
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:2416"
variation 1530..1531
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="tcaa"
/db_xref="dbSNP:374990567"
variation 1589
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:146937021"
variation 1591
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:77933598"
variation 1593
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:12555646"
variation 1650
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:182662225"
variation 1662
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:147972018"
variation 1684
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186630550"
variation 1771
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191474528"
variation 1791
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185386620"
variation 1831
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141687734"
variation 1901
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:28687204"
variation 1952
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:11556890"
variation 1988
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:189086459"
STS 2060..2193
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH77983"
/db_xref="UniSTS:226"
variation 2129
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:192831011"
variation 2170
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:150524435"
variation 2179
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="t"
/db_xref="dbSNP:139595461"
variation 2184
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:76125733"
STS 2278..2515
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11599"
/db_xref="UniSTS:61308"
STS 2301..2574
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="A006A17"
/db_xref="UniSTS:68860"
STS 2301..2574
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="G20648"
/db_xref="UniSTS:68859"
variation 2330
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:371394348"
variation 2344
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:146280734"
variation 2350
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:13467"
variation 2352
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185361860"
variation 2432
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:377058344"
variation 2483
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:189170661"
polyA_signal 2533..2538
/gene="NEK6"
/gene_synonym="SID6-1512"
polyA_site 2582
/gene="NEK6"
/gene_synonym="SID6-1512"
ORIGIN
gcaatgctaggcgatggggaatccgaagacgcacaggagtccaagggttggctgactgcagaccctcatcataagtctagagccggagaagatggggagacgccggcctgcgccctttcgtgccctcgtgaggctggcatgcaggatggcaggacagcccggccacatgccccatggagggagttccaacaacctctgccacaccctggggcctgtgcatcctcctgacccacagaggcatcccaacacgctgtcttttcgctgctcgctggcggacttccagatcgaaaagaagataggccgaggacagttcagcgaggtgtacaaggccacctgcctgctggacaggaagacagtggctctgaagaaggtgcagatctttgagatgatggacgccaaggcgaggcaggactgtgtcaaggagatcggcctcttgaagcaactgaaccacccaaatatcatcaagtatttggactcgtttatcgaagacaacgagctgaacattgtgctggagttggctgacgcaggggacctctcgcagatgatcaagtactttaagaagcagaagcggctcatcccggagaggacagtatggaagtactttgtgcagctgtgcagcgccgtggagcacatgcattcacgccgggtgatgcaccgagacatcaagcctgccaacgtgttcatcacagccacgggcgtcgtgaagctcggtgaccttggtctgggccgcttcttcagctctgagaccaccgcagcccactccctagtggggacgccctactacatgtcaccggagaggatccatgagaacggctacaacttcaagtccgacatctggtccctgggctgtctgctgtacgagatggcagccctccagagccccttctatggagataagatgaatctcttctccctgtgccagaagatcgagcagtgtgactaccccccactccccggggagcactactccgagaagttacgagaactggtcagcatgtgcatctgccctgacccccaccagagacctgacatcggatacgtgcaccaggtggccaagcagatgcacatctggatgtccagcacctgagcgtggatgcaccgtgccttatcaaagccagcaccactttgccttacttgagtcgtcttctcttcgagtggccacctggtagcctagaacagctaagaccacagggttcagcaggttccccaaaaggctgcccagccttacagcagatgctgaaggcagagcagctgagggaggggcgctggccacatgtcactgatggtcagattccaaagtcctttctttatactgttgtggacaatctcagctgggtcaataagggcaggtggttcagcgagccacggcagccccctgtatctggattgtaatgtgaatctttagggtaattcctccagtgacctgtcaaggcttatgctaacaggagacttgcaggagaccgtgtgatttgtgtagtgagcctttgaaaatggttagtaccgggttcagtttagttcttagtatcttttcaatcaagctgtgtgcttaatttactctgttgtaaagggataaagtggaaatcatttttttccgtggagtggtgattctgctaacatttttatctacgttttataacttggtgagtgacgatgagagccctgcacctggccagagtgtcacaggcaaaaggcatcgggaagcaggagcatcttcttggcagccaggctgggccatcttctcctggacacctgctgtgtaccaggaacttcgtcacctccttgaatgctggcggttcatttcatgatcagtgttaagcattttcctccatgggaaggaagcatgggatatagaaaagcgaagggctgtcctttacaaattctggttctgcaacttcctagcgtgactttgggcttgggcaagtttcttagccgttctgagccttcatttcctcatctgtacaatgagattaatagtacctatcatctaccttcaggattgctgacagacagaatttgaaataaaatatgcaagttagctaatacaaaaagtagatgatccaaaaatggtagccactcacccttcacaaactgaagtccatggaccacggaagtcgagaattaatgtacacctgtatcatgtgtaggaaaccagaaatgtgttccttatttcttgttcccaaacaggattaactgtgaagactaatttataaatgtgaacctaagaaaactccacctctgaaggaaatcatttgaattttgtttttgtacgtaaagttaaccttccaattgtctgagctgtcgtcactgacttcatgacagtctggccctccagacaagagcagcgctggcatcgggcaggtgattcctgacacctgctgcctgcaggcattcactgaccaggcctttcctggaggaaacacccagggccgggcggctgctgtttccacacgtggactcggatctgctgtgacaccgtcagcccgacagtctctccatatgcagcctttcctctgtacttttctccatggttgaaataaaacagggtgactgggagttacttagaattcatgaagattttaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10783 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004871 [signal transducer activity] evidence: IMP
GeneID:10783 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0005524 [ATP binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0019894 [kinesin binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:10783 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0000910 [cytokinesis] evidence: TAS
GeneID:10783 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10783 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
GeneID:10783 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:10783 -> Biological process: GO:0007077 [mitotic nuclear envelope disassembly] evidence: TAS
GeneID:10783 -> Biological process: GO:0007165 [signal transduction] evidence: IMP
GeneID:10783 -> Biological process: GO:0007346 [regulation of mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0030071 [regulation of mitotic metaphase/anaphase transition] evidence: IDA
GeneID:10783 -> Biological process: GO:0031572 [G2 DNA damage checkpoint] evidence: IMP
GeneID:10783 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IMP
GeneID:10783 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0051225 [spindle assembly] evidence: TAS
GeneID:10783 -> Biological process: GO:2000772 [regulation of cellular senescence] evidence: TAS
GeneID:10783 -> Cellular component: GO:0000922 [spindle pole] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10783 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
GeneID:10783 -> Cellular component: GO:0016607 [nuclear speck] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001159639 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.