GGRNA Home | Help | Advanced search

2019-03-24 20:08:05, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001162536            5128 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens RNA binding motif protein, X-linked-like 1 (RBMXL1),
            transcript variant 1, mRNA.
ACCESSION   NM_001162536
VERSION     NM_001162536.2  GI:242247050
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5128)
  AUTHORS   Martins-de-Souza,D., Gattaz,W.F., Schmitt,A., Rewerts,C.,
            Maccarrone,G., Dias-Neto,E. and Turck,C.W.
  TITLE     Prefrontal cortex shotgun proteome analysis reveals altered calcium
            homeostasis and immune system imbalance in schizophrenia
  JOURNAL   Eur Arch Psychiatry Clin Neurosci 259 (3), 151-163 (2009)
   PUBMED   19165527
REFERENCE   2  (bases 1 to 5128)
  AUTHORS   Marques,A.C., Dupanloup,I., Vinckenbosch,N., Reymond,A. and
            Kaessmann,H.
  TITLE     Emergence of young human genes after a burst of retroposition in
            primates
  JOURNAL   PLoS Biol. 3 (11), E357 (2005)
   PUBMED   16201836
REFERENCE   3  (bases 1 to 5128)
  AUTHORS   Emerson,J.J., Kaessmann,H., Betran,E. and Long,M.
  TITLE     Extensive gene traffic on the mammalian X chromosome
  JOURNAL   Science 303 (5657), 537-540 (2004)
   PUBMED   14739461
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC397531.1, DA216732.1,
            BC012942.1, BF901720.1 and AL832785.1.
            On Jun 27, 2009 this sequence version replaced gi:242117970.
            
            Summary: This gene represents a retrogene of RNA binding motif
            protein, X-linked (RBMX), which is located on chromosome X. While
            all introns in the coding sequence have been processed out compared
            to the RBMX locus, the ORF is intact and there is specific evidence
            for transcription at this location. The preservation of the ORF by
            purifying selection in all Old World monkeys carrying it suggests
            that this locus is likely to be functional, possibly during male
            meiosis when X chromosomal genes are silenced or during haploid
            stages of spermatogenesis. This gene shares 5' exon structure with
            the cysteine conjugate-beta lyase 2 locus on chromosome 1, but the
            coding sequences are non-overlapping. Alternative splicing results
            in two transcript variants. [provided by RefSeq, Jun 2009].
            
            Transcript Variant: This variant (1) represents the longer
            transcript. Both variants 1 and 2 encode the same protein.
            
            CCDS Note: This CCDS represents a retrogene of RBMX (RNA binding
            motif protein, X-linked), which is located on chromosome X. While
            all introns in the coding sequence have been processed out compared
            to the RBMX locus, the ORF is intact and there is specific evidence
            for transcription at this location. Studies in PMID:16201836
            indicate that this locus is likely to be functional because the ORF
            has been preserved by purifying selection in all six Old World
            primates carrying this retrogene. Given that X chromosomal genes in
            mammals can generate a statistically significant excess of
            autosomal retrogenes relative to genes on other chromosomes
            (PMID:14739461), it is possible that this retrogene may be
            functional during male meiosis when X chromosomal genes are
            silenced or during haploid stages of spermatogenesis
            (PMID:16201836). In addition, it should be noted that this
            retrogene shares its first non-coding exon with the cysteine
            conjugate-beta lyase 2 (CCBL2) locus on chromosome 1, but the
            coding sequences are non-overlapping.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX418820.2, BQ421290.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-160               DC397531.1         68-227
            161-693             DA216732.1         3-535
            694-2247            BC012942.1         253-1806
            2248-2272           BF901720.1         413-437
            2273-4118           BC012942.1         1832-3677
            4119-5128           AL832785.1         2960-3969
FEATURES             Location/Qualifiers
     source          1..5128
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p22.2"
     gene            1..5128
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /note="RNA binding motif protein, X-linked-like 1"
                     /db_xref="GeneID:494115"
                     /db_xref="HGNC:25073"
     exon            1..376
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /inference="alignment:Splign:1.39.8"
     exon            377..476
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /inference="alignment:Splign:1.39.8"
     exon            477..5087
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    675..677
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /note="upstream in-frame stop codon"
     CDS             717..1889
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /note="heterogeneous nuclear ribonucleoprotein G-like 1"
                     /codon_start=1
                     /product="RNA binding motif protein, X-linked-like-1"
                     /protein_id="NP_001156008.1"
                     /db_xref="GI:242117971"
                     /db_xref="CCDS:CCDS716.1"
                     /db_xref="GeneID:494115"
                     /db_xref="HGNC:25073"
                     /translation="
MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSRDSYSSSSRGAPRGAGPGGSRSDRGGGRSRY
"
     misc_feature    741..962
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /note="RRM (RNA recognition motif), also known as RBD (RNA
                     binding domain) or RNP (ribonucleoprotein domain), is a
                     highly abundant domain in eukaryotes found in proteins
                     involved in post-transcriptional gene expression processes
                     including mRNA and rRNA...; Region: RRM; cd00590"
                     /db_xref="CDD:100104"
     misc_feature    order(747..749,867..869,873..875)
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /note="RNA/DNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100104"
     misc_feature    957..962
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /note="RRM dimerization site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100104"
     misc_feature    978..980
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q96E39.1); phosphorylation site"
     misc_feature    1197..1199
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q96E39.1); phosphorylation site"
     misc_feature    1233..1367
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /note="RBM1CTR (NUC064) family; Region: RBM1CTR;
                     pfam08081"
                     /db_xref="CDD:149260"
     variation       3372
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3209411"
     STS             3850..3934
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /standard_name="RH93455"
                     /db_xref="UniSTS:92375"
     STS             3891..4050
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /standard_name="A004S46"
                     /db_xref="UniSTS:70793"
     variation       4090
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1053196"
     STS             4822..4998
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
                     /standard_name="SHGC-75112"
                     /db_xref="UniSTS:69922"
     polyA_signal    5067..5072
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
     polyA_site      5087
                     /gene="RBMXL1"
                     /gene_synonym="RBM1"
ORIGIN      
gtggcccccaccccttccctcctccatttccatccattccgcgatcgcggcggaccccaccgtcatcgcgcgccgtgagtcacactccacagccaatccctggccacatccgggctcgcccccgccccgcccccttgttcccgcaagcccggaactgcccaaatcccgcccctcccctcccaaaaaaacacccctcatccagtctcttccagcctagagatcctggcctacccctccgccaaagcgcgcactgagtgcaaaccccagagtcaatccctgtcccggctccgccccccgcgtccgaatcccgcccagccgggccctcaagcccagtcgggactcgagcctagggaggcgaggttcccgcaccggatagcatgtttttggcccagaggagcctctgctctcttagcggtagagcaaaattcctgaagacaatttcttcttccaaaatcctcggattctctacttctgctgaacattctgttgttttcctctgccatctagtggcaaaagaaagtaattttcctggttttttgaatggatagccataccttaaaaagcatccagattgcgcagtagtgctagcggcttcgcggttcagtcctcctaactgacagccgccactggtgctgagctgctaggaagcccctgtcggcgagcttgttggagcttgaacccactgtcacccctccgactcaccggcaaaaaaaaaaatggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaatgagaaagctcttgaaacagtatttggcaaatatggacgaatagtggaagtactcttgataaaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagcagacgctaaggatgcagccagagacatgaatggaaagtcattagatggaaaagccatcaaggtggaacaagccaccaaaccatcatttgaaagaggtagacatggaccgcccccacctccaagaagtagaggtcctccaagaggttttggagctggaagaggaggaagtggaggaaccaggggacctccttcacgaggaggacacatggatgatggtggatattccatgaattttaacatgagttcttccaggggaccactcccagtaaaaagaggaccaccaccaagaagtgggggtccttctcctaagagatctgcaccttcaggactagttcgcagcagcagtggaatgggaggaagagctcctctatcacgtggaagagatagttatggaggtccacctcgaagggaaccgctcccctctcgtagagatgtttatttgtccccaagagatgatgggtattctactaaagacagctattcaagcagagattacccaagttctcgtgatacaagagattatgcaccaccaccacgagattatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggctatggcgatagagatggatatggtcgtgatcgtgactattcagatcatccaagtggaggttcctacagagattcatatgagagttatggtaactcacgtagtgctccacttacacgagggcccccgccatcttatggtggaagcagtcgctatgatgattatagcagctcacgtgatggatatggtggaagtcgagacagttactcaagcagccgaagtgatctctactcaagttgtgacagggttggcagacaagaaagagggcttcccccttctgtagaaagggggtacccttcttcacgtgattcctacagcagttcaagccgcggagcaccaagaggtgctggccctggaggaagccgatctgatagagggggaggcagaagcagatactagaaacaaacaaaactttggaccaaaatcccagttcaaagaaacaaaaaaaagagtggaaactattctatcataactacccaaggactactaaaaggaaaaattgtgttaccttttttaaattccctgttaagtcccttccgtaatttttatgttcttgtgaggaaaaaagtaaaacatgtttaattttatttgactttatgacattgcttttcaacaagcaaatgttaaatgtgttaagccttgtagtactagtgttgtaactttccaagtaaaggtgtccctaaagaccacttcctatctggtttttcccagtaaatgaggcaagcaattctaagatcttccacaaaacatctagccaactaaaatggagagatgaatcattctgcctatacaaacaagctagctattagagggtggttggagtatgctactcataagatttcagggtgttttctaactgaaatctcactgttctcagtatgcaaaacctgaaatcagatgcctatgtaaggaaagtgctattcacccagtaaacccaaaaaaagcaaatggataatgctggccattttgcctttctgacatttccttgggaatctgcaagaacctcccctttcccctcccacaataagaccatttaagtgtgtgctaaacaactacggaatactaaataaaaagtttggccaaaaccaaccatgaagctgcaaaggtgcttgctcttactctttcaaatttttgcaactctaatgtctcacttttaaaggaacagcttgattgcaaaggagaaaatagataagcaatgaatttatctccaacttcctaaaggcttatgacttctaaaaagtgaatctatcagcattccacatcagatttaaagcatcaaatgcctgtgaaacagcaaagatggttgaagattgtgctcattatgtttgtggagtgctgattgattcacagtagataacgctggcagtaagagaaatcaaatgctaagagttgttgaagcagaaggcggctgattgttggtaagtcagtgcagttgcataagcagtgctgtcagaattggtttggtgcaggcaatagattttgccttcaagggttcctgtggatctcaggaaggcatcagtgttgattaacactcataactagggagtgagtggtagttacttaagtaattgaccaaatggaaaaggggaagtaattaaggaaattggtaagtggaggtagtcaggaggttctcgtggtcctttacacagattttacagctttgggtttcattttgtttagctaaagtcatggggacaactcttcaatttagaacttaagatgaattataaaaatgatggatataagtggtagctctatctggtgaagtgtcttgtcagtaagtgaaacatttttttgtggtggcttatccacaaacagtttagttgtagaataaaacttatgagtgacatctggaaagtaacaaccatgctaagatggcaaacacactggaaacaattgggccacttggctttcttttgctgtattgttttataagcctgctttacctccccgtcttggaaacaagttttagtttattgctttggagactagagccaatagtgtaatgttctcaaaggaaacagacttgagttgttggattagaggaactaactcaacttctaattttttttgttgtaattatggcactgtcatgttttaacatttgcaactagggatagtaagtacaacatttttaactctcatttggcagactactactaatcacagaccacaagggtaatgaccaaatttatgtggttgttacacttccatagttgtcttagccgaatccttccatattcttatgattacttgggttaaagcttctgtgaggaccttttggctcttaagatatcctaaatatttaaaatatttagatatcctaaatataggatatagagtttgtaccaaatatgaatgaatattgttcaaagcaaggagtatgttaaaatgaccagacacctgtttgataaatagtttactgaactagcagacgtgtggaaaaagaatcagatcttgattcttctgggtttatactggttgtaaaacagaatgatattagaaaatgttttccttgtttaagtggtagttgaacatagaacttgggtattatagatcacttttcactttttggaatgttttgtattgaaacttaatacaactttaacatggcaaaaaaaaaaaaaatccaaaatctatgagataattttgttaaagttggcttgcttgggcgggtgcttggtccagagggagaaaagaaggcatgatttcagaatactctggcagctttttaaattcagctttatcaagttacagtaaactgtatctgtttagaattacaactcaatggttattttgacagatgtatatgccatgaagccactgtcaccatcaacatgcagaacacttccatcgcccccaaaagattcctcaagttcctttgcagtccatccctcacgctgctgatttgtctttgtcaccatatattagtttgctttgtggtggtgtttagtattttatataaatgggattgtgtagcatgtacttttttgtttatggtttctttcacacacaatgactttgaaattcaccaggttgcagtgtatcagtagcttattccttttattgctgagtagtgtcccattatgtgaatatgccattatttgtttttctactcacctgttgatggaccttgggattgtttccagtttggggctactgtgaataaaactgttaggaacatttgtgtacaagccactgtgtagacataggttttcctttctcttgggtaaatacctaccagtaaaatggttgggttgcatggcagatttatgtttaataaagtaactgccaaactgtttgttttccaaaggggctatacccttttatattcccaccagggttgtatagagttccaactgccaacactcagttttcagccattctgatgggaatctagtggtatctcattgtggttttattttcatttccccgggtgactaatgctggtaagcatcttttaaggtactttttggccagttgtatattttctgtgaagtggctgtcaaatcttttgcccacttttaattggattgtttgtcttattgagttgtaaaagttctttatatatactgtattaaagtcctttgtaagacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:494115 -> Molecular function: GO:0000166 [nucleotide binding] evidence: IEA
            GeneID:494115 -> Molecular function: GO:0003723 [RNA binding] evidence: IEA
            GeneID:494115 -> Biological process: GO:0006397 [mRNA processing] evidence: IEA
            GeneID:494115 -> Biological process: GO:0008380 [RNA splicing] evidence: IEA
            GeneID:494115 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
            GeneID:494115 -> Cellular component: GO:0030529 [ribonucleoprotein complex] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.